GLXR5 Antibody

Images

 
Western Blot: GLXR5 Antibody [NBP1-89897] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: GLXR5 Antibody [NBP1-89897] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLXR5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLRX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLXR5 Protein (NBP1-89897PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLXR5 Antibody

  • C14orf87chromosome 14 open reading frame 87
  • FLB4739
  • glutaredoxin 5 homolog (S. cerevisiae)
  • glutaredoxin 5 homolog
  • glutaredoxin 5
  • glutaredoxin-related protein 5, mitochondrial
  • GRX5
  • MGC14129
  • Monothiol glutaredoxin-5
  • PR01238
  • PRO1238

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000212-M01
Species: Hu, Mu
Applications: WB, ELISA
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89313
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3119
Species: Mu
Applications: WB
NBP1-90040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF7560
Species: Hu, Mu, Rt
Applications: WB
NBP1-59559
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-86983
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89897
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GLXR5 Antibody (NBP1-89897) (0)

There are no publications for GLXR5 Antibody (NBP1-89897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLXR5 Antibody (NBP1-89897) (0)

There are no reviews for GLXR5 Antibody (NBP1-89897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GLXR5 Antibody (NBP1-89897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLXR5 Products

Bioinformatics Tool for GLXR5 Antibody (NBP1-89897)

Discover related pathways, diseases and genes to GLXR5 Antibody (NBP1-89897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLXR5 Antibody (NBP1-89897)

Discover more about diseases related to GLXR5 Antibody (NBP1-89897).
 

Pathways for GLXR5 Antibody (NBP1-89897)

View related products by pathway.

PTMs for GLXR5 Antibody (NBP1-89897)

Learn more about PTMs related to GLXR5 Antibody (NBP1-89897).

Blogs on GLXR5

There are no specific blogs for GLXR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLXR5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRX5