AKR7A2 Antibody


Western Blot: AKR7A2 Antibody [NBP1-98519] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Liver.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

AKR7A2 Antibody Summary

The immunogen for this antibody is AKR7A2 - N-terminal region. Peptide sequence SETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AKR7A2 Antibody

  • AFAR1
  • AFB1 aldehyde reductase 1
  • AFB1-AR 1
  • aflatoxin B1 aldehyde reductase member 2
  • aflatoxin beta1 aldehyde reductase
  • AKR7
  • aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
  • Aldoketoreductase 7
  • EC 1.1.1.n11
  • SSA reductase
  • Succinic semialdehyde reductase


The protein encoded by this gene belongs to the aldo/keto reductase (AKR) superfamily and AKR7 family, which are involved in the detoxification of aldehydes and ketones. The AKR7 family consists of 3 genes that are present in a cluster on the p arm of chromosome 1. This protein, thought to be localized in the golgi, catalyzes the NADPH-dependent reduction of succinic semialdehyde to the endogenous neuromodulator, gamma-hydroxybutyrate. It may also function as a detoxication enzyme in the reduction of aflatoxin B1 and 2-carboxybenzaldehyde.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA

Publications for AKR7A2 Antibody (NBP1-98519) (0)

There are no publications for AKR7A2 Antibody (NBP1-98519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR7A2 Antibody (NBP1-98519) (0)

There are no reviews for AKR7A2 Antibody (NBP1-98519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKR7A2 Antibody (NBP1-98519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AKR7A2 Products

Bioinformatics Tool for AKR7A2 Antibody (NBP1-98519)

Discover related pathways, diseases and genes to AKR7A2 Antibody (NBP1-98519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR7A2 Antibody (NBP1-98519)

Discover more about diseases related to AKR7A2 Antibody (NBP1-98519).

Pathways for AKR7A2 Antibody (NBP1-98519)

View related products by pathway.

PTMs for AKR7A2 Antibody (NBP1-98519)

Learn more about PTMs related to AKR7A2 Antibody (NBP1-98519).

Blogs on AKR7A2

There are no specific blogs for AKR7A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AKR7A2 Antibody and receive a gift card or discount.


Gene Symbol AKR7A2