AKR7A2 Antibody

Images

 
Western Blot: AKR7A2 Antibody [NBP1-98519] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

AKR7A2 Antibody Summary

Immunogen
The immunogen for this antibody is AKR7A2 - N-terminal region. Peptide sequence SETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQ.
Clonality
Polyclonal
Host
Rabbit
Gene
AKR7A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AKR7A2 Antibody

  • AFAR1
  • AFARAFB1-AR1
  • AFB1 aldehyde reductase 1
  • AFB1-AR 1
  • aflatoxin B1 aldehyde reductase member 2
  • aflatoxin beta1 aldehyde reductase
  • AKR7
  • aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
  • Aldoketoreductase 7
  • EC 1.1.1.n11
  • SSA reductase
  • Succinic semialdehyde reductase

Background

The protein encoded by this gene belongs to the aldo/keto reductase (AKR) superfamily and AKR7 family, which are involved in the detoxification of aldehydes and ketones. The AKR7 family consists of 3 genes that are present in a cluster on the p arm of chromosome 1. This protein, thought to be localized in the golgi, catalyzes the NADPH-dependent reduction of succinic semialdehyde to the endogenous neuromodulator, gamma-hydroxybutyrate. It may also function as a detoxication enzyme in the reduction of aflatoxin B1 and 2-carboxybenzaldehyde.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00221357-D01P
Species: Hu
Applications: WB, ELISA
NBP1-86996
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-92033
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31614
Species: Hu
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA

Publications for AKR7A2 Antibody (NBP1-98519) (0)

There are no publications for AKR7A2 Antibody (NBP1-98519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR7A2 Antibody (NBP1-98519) (0)

There are no reviews for AKR7A2 Antibody (NBP1-98519). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKR7A2 Antibody (NBP1-98519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKR7A2 Antibody Products

Related Products by Gene

Bioinformatics Tool for AKR7A2 Antibody (NBP1-98519)

Discover related pathways, diseases and genes to AKR7A2 Antibody (NBP1-98519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR7A2 Antibody (NBP1-98519)

Discover more about diseases related to AKR7A2 Antibody (NBP1-98519).
 

Pathways for AKR7A2 Antibody (NBP1-98519)

View related products by pathway.

PTMs for AKR7A2 Antibody (NBP1-98519)

Learn more about PTMs related to AKR7A2 Antibody (NBP1-98519).

Blogs on AKR7A2

There are no specific blogs for AKR7A2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol AKR7A2
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98519 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought