Home » AKIRIN1 » AKIRIN1 Antibodies » AKIRIN1 Antibody

AKIRIN1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: AKIRIN1 Antibody [NBP2-14749] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunocytochemistry/ Immunofluorescence: AKIRIN1 Antibody [NBP2-14749] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: AKIRIN1 Antibody [NBP2-14749] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AKIRIN1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKIRIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For IF, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
AKIRIN1 Protein (NBP2-14749PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKIRIN1 Antibody

  • AKIRIN1 akirin 1
  • C1orf108
  • RP11-781D11.2
  • STRF2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Akirin2 Antibody
(3D9)
H00055122-M01
Sandwich ELISA: Akirin2 Antibody (3D9) [H00055122-M01] - Detection limit for recombinant GST tagged AKIRIN2 is 0.3 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Akirin2 Antibody (3D9) [H00055122-M01] - Analysis of monoclonal antibody to AKIRIN2 on HeLa cell . Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
MEF2A Antibody
(1C8)
H00004205-M15
Western Blot: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of MEF2A expression in MCF-7 (Cat # L046V1).
ELISA: MEF2A Antibody (1C8) [H00004205-M15] - Detection limit for recombinant GST tagged MEF2A is approximately 0.3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of monoclonal antibody to MEF2A on MCF-7 cell. Image from verified customer review
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, WB
Twist-1 Antibody
(10E4E6) - BSA Free
NBP2-37364
Flow Cytometry: Twist-1 Antibody (10E4E6) [NBP2-37364] - An intracellular stain was performed on HeLa cells with Twist-1 Antibody (10E4E6)NBP2-37364R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550.
Flow (Intracellular): Twist-1 Antibody (10E4E6) [NBP2-37364] - An intracellular stain was performed on HeLa cells with Twist-1 Antibody (10E4E6)NBP2-37364R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550. Image from the DyLight 550 version of this antibody.
Flow Cytometry: Twist-1 Antibody (10E4E6) [NBP2-37364] - An intracellular stain was performed on SH-SY5Y cells with Twist-1 Antibody (10E4E6) NBP2-37364R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
GDF-8/Myostatin
[Unconjugated]
788-G8/CF
1 μg/lane of Recombinant Human/Mouse/Rat GDF-8/Myostatin was resolved withSDS-PAGE under reducing (R) andnon-reducing (NR) conditions and visualized by silver staining, showing the main bands at 12 kDa and 24 kDa, respectively.
Recombinant Human/Mouse/Rat GDF-8/Myostatin (Catalog # 788-G8/CF) induces hemoglobin expression in the K562 human chronic myelogenous leukemia cell line. The ED50 for this effect is 2-10 ng/mL.
(41 Publications)
Species: Hu, Mu, Rt
Applications: BA
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: CyTOF-ready, Flow, WB
ZBTB7A/Pokemon
Antibody
NBP2-23673
Immunohistochemistry-Paraffin: ZBTB7A/Pokemon Antibody [NBP2-23673] - Analysis of human skin using Pokemon antibody at 1:100.
Western Blot: ZBTB7A/Pokemon Antibody [NBP2-23673] - Analysis of Pokemon in MCF7 cell lysate. Lane 1 shows pre-immune sera and lane 2 shows Pokemon antibody tested on MCF7 at 1:1000 dilution.
(1 Review)
(1 Publication)
Species: Ch, Pm, Hu, Mu, Ma-Op, Rt
Applications: IHC, IHC-P, Simple Western (-), WB
IGF-II/IGF2
[Unconjugated]
292-G2
1 μg/lane of Recombinant Human IGF‑II/IGF2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-II/IGF2 (Catalog # 292‑G2) stimulates cell proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 1.5‑6 ng/mL.
(41 Publications)
Species: Hu
Applications: BA
14-3-3 Antibody
NBP2-27202
Simple Western: 14-3-3 Antibody [NBP2-27202] - Analysis in mouse brain lysate. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: 14-3-3 Antibody [NBP2-27202] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-14-3-3 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: 14-3-3 Antibody [NBP2-27202] - analysis of 14-3-3 using 14-3-3 antibody. Human Brain tissue lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain, and 4) rat brain lysate probed with 2 ug/ml of 14-3-3 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
SMARCA1 Antibody
(2H7B8) - BSA Free
NBP2-61879
ELISA: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of NIH/3T3 cells using SMARCA1 mouse mAb (green) and negative control (red).
Immunohistochemistry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of paraffin-embedded esophageal cancer tissues using SMARCA1 mouse mAb with DAB staining.
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
BRM Antibody
NBP3-13283
Immunohistochemistry-Paraffin: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus in mouse brain by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. BRM antibody (NBP3-13283) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus in mouse testis by immunohistochemical analysis. Sample: Paraffin-embedded mouse testis. BRM antibody (NBP3-13283) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: BRM stained by BRM antibody (NBP3-13283) diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar= 10 um.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Trappin-2/Elafin/Skalp
DY1747
(15 Publications)
Species: Hu
Applications: ELISA
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(10 Reviews)
(45 Publications)
Species: Hu
Applications: IHC, IP, WB
Myogenin Antibody
(5FD) - BSA Free
NB100-56510
Immunohistochemistry-Frozen: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin in human alveolar rhabdomyosarcoma using NB100-56510 at 5 ug/mL.
Immunohistochemistry: Myogenin Antibody (5FD) [NB100-56510] - Human myocytes using NB100-56703 at 2.5 ug/mL. Hematoxylin-eosin counterstain.
Western Blot: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin expression in various small-round cell tumor lines. The antibody strongly reacted with a band at ~34 kDa in alveolar rhobdomyosarcoma line (Rh30). Negative cell lines were PFSK-1, EB2, SK-N-SH, and SJSA-1.
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AKIRIN1 Antibody
NBP2-14749
AKIRIN1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AKIRIN1 Antibody (NBP2-14749) (0)

There are no publications for AKIRIN1 Antibody (NBP2-14749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKIRIN1 Antibody (NBP2-14749) (0)

There are no reviews for AKIRIN1 Antibody (NBP2-14749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AKIRIN1 Antibody (NBP2-14749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKIRIN1 Products

Bioinformatics Tool for AKIRIN1 Antibody (NBP2-14749)

Discover related pathways, diseases and genes to AKIRIN1 Antibody (NBP2-14749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKIRIN1 Antibody (NBP2-14749)

Discover more about diseases related to AKIRIN1 Antibody (NBP2-14749).
 

Pathways for AKIRIN1 Antibody (NBP2-14749)

View related products by pathway.

Research Areas for AKIRIN1 Antibody (NBP2-14749)

Find related products by research area.

Blogs on AKIRIN1

There are no specific blogs for AKIRIN1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKIRIN1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AKIRIN1
Entrez
Uniprot