AKIRIN1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AKIRIN1 Antibody [NBP2-14749] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: AKIRIN1 Antibody [NBP2-14749] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKIRIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAP SSPGSSWMKKDQPTFT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKIRIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For IF, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
AKIRIN1 Protein (NBP2-14749PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKIRIN1 Antibody

  • AKIRIN1 akirin 1
  • C1orf108
  • RP11-781D11.2
  • STRF2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055122-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-23673
Species: Hu, Mu, Rt, Ch, Op
Applications: WB, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14749
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AKIRIN1 Antibody (NBP2-14749) (0)

There are no publications for AKIRIN1 Antibody (NBP2-14749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKIRIN1 Antibody (NBP2-14749) (0)

There are no reviews for AKIRIN1 Antibody (NBP2-14749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AKIRIN1 Antibody (NBP2-14749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKIRIN1 Products

AKIRIN1 NBP2-14749

Bioinformatics Tool for AKIRIN1 Antibody (NBP2-14749)

Discover related pathways, diseases and genes to AKIRIN1 Antibody (NBP2-14749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKIRIN1 Antibody (NBP2-14749)

Discover more about diseases related to AKIRIN1 Antibody (NBP2-14749).
 

Pathways for AKIRIN1 Antibody (NBP2-14749)

View related products by pathway.

Blogs on AKIRIN1

There are no specific blogs for AKIRIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKIRIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKIRIN1
Entrez
Uniprot