Akirin2 Antibody (3D9)

Images

 
Immunocytochemistry/ Immunofluorescence: Akirin2 Antibody (3D9) [H00055122-M01] - Analysis of monoclonal antibody to AKIRIN2 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: Akirin2 Antibody (3D9) [H00055122-M01] - Detection limit for recombinant GST tagged AKIRIN2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Akirin2 Antibody (3D9) Summary

Immunogen
C6orf166 (AAH00764, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS
Specificity
C6orf166 - chromosome 6 open reading frame 166 (3D9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKIRIN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Akirin2 Antibody (3D9)

  • akirin 2
  • akirin-2
  • C6orf166
  • chromosome 6 open reading frame 166
  • dJ486L4.2
  • FBI1
  • FLJ10342
  • fourteen-three-three beta interactant 1

Background

Akirin2 is required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to represstranscription of DUSP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-834
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-23673
Species: Ch, Pm, Hu, Mu, Ma-Op, Rt
Applications: IHC, IHC-P, Simple Western (-), WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
DMP900
Species: Hu
Applications: ELISA
NBP2-38025
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14749
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01340
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-18420
Species: Hu
Applications: IP, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
H00004205-M15
Species: Hu
Applications: ELISA, ICC/IF, WB
292-G2
Species: Hu
Applications: BA
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for Akirin2 Antibody (H00055122-M01) (0)

There are no publications for Akirin2 Antibody (H00055122-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Akirin2 Antibody (H00055122-M01) (0)

There are no reviews for Akirin2 Antibody (H00055122-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Akirin2 Antibody (H00055122-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Akirin2 Products

Diseases for Akirin2 Antibody (H00055122-M01)

Discover more about diseases related to Akirin2 Antibody (H00055122-M01).
 

Pathways for Akirin2 Antibody (H00055122-M01)

View related products by pathway.

Research Areas for Akirin2 Antibody (H00055122-M01)

Find related products by research area.

Blogs on Akirin2

There are no specific blogs for Akirin2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Akirin2 Antibody (3D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol AKIRIN2
Entrez
Uniprot