AK5 Antibody - BSA Free

Western Blot: AK5 Antibody [NBP2-33821] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: AK5 Antibody [NBP2-33821] - Staining in human cerebral cortex and liver tissues using anti-AK5 antibody. Corresponding AK5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AK5 Antibody [NBP2-33821] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: AK5 Antibody [NBP2-33821] - Staining of human liver shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AK5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AK5 Antibody - BSA Free (NBP2-33821) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD
• Predicted Species: Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AK5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AK5 Protein (NBP2-33821PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AK5 Antibody - BSA Free

• adenylate kinase 5
• adenylate kinase 6
• adenylate kinase isoenzyme 5
• AK 5
• AK5
• AK6
• ATP-AMP transphosphorylase 5
• EC 2.7.4.3
• MGC33326

Background

AK5 encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AK5
• Uniprot:
  • Q9Y6K8(Human)