AK5 Antibody

Images

 
Western Blot: AK5 Antibody [NBP1-89453] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: AK5 Antibody [NBP1-89453] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: AK5 Antibody [NBP1-89453] - Staining of human hippocampus shows strong cytoplasmic and nucleolar positivity in neuronal cells.
Immunocytochemistry/ Immunofluorescence: AK5 Antibody [NBP1-89453] - Staining of human cell line U-2 OS shows positivity in cytoplasm and centrosome.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AK5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500-1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AK5 Protein (NBP1-89453PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AK5 Antibody

  • adenylate kinase 5
  • adenylate kinase 6
  • adenylate kinase isoenzyme 5
  • AK 5
  • AK6
  • ATP-AMP transphosphorylase 5
  • EC 2.7.4.3
  • MGC33326

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00827
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86043
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-79616
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-90954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-57365
Species: Hu
Applications: WB
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5659
Species: Hu
Applications: WB
NBP1-89453
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AK5 Antibody (NBP1-89453) (0)

There are no publications for AK5 Antibody (NBP1-89453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AK5 Antibody (NBP1-89453) (0)

There are no reviews for AK5 Antibody (NBP1-89453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AK5 Antibody (NBP1-89453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AK5 Products

Bioinformatics Tool for AK5 Antibody (NBP1-89453)

Discover related pathways, diseases and genes to AK5 Antibody (NBP1-89453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AK5 Antibody (NBP1-89453)

Discover more about diseases related to AK5 Antibody (NBP1-89453).
 

Pathways for AK5 Antibody (NBP1-89453)

View related products by pathway.

PTMs for AK5 Antibody (NBP1-89453)

Learn more about PTMs related to AK5 Antibody (NBP1-89453).

Blogs on AK5

There are no specific blogs for AK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AK5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AK5
Entrez
Uniprot