AK3L1 Recombinant Protein Antigen

Images

 
There are currently no images for AK3L1 Protein (NBP2-47553PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AK3L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AK4.

Source: E. coli

Amino Acid Sequence: PEAVAARLRQYKDVAKPVIELYKSRGVLHQF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AK4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47553.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AK3L1 Recombinant Protein Antigen

  • adenylate kinase 3
  • adenylate kinase 3-like 1
  • Adenylate kinase 3-like
  • adenylate kinase 4
  • AK 4
  • AK3
  • AK3adenylate kinase isoenzyme 4, mitochondrial
  • AK3L1
  • AK3L2
  • AK4
  • ATP-AMP transphosphorylase
  • EC 2.7.4
  • EC 2.7.4.3
  • GTP:AMP phosphotransferase
  • MGC166959
  • mitochondrial adenylate kinase-3
  • nucleoside-triphosphate-adenylate kinase

Background

AK3L1 encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87401
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33160
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-87677
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02978
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
137-PS
Species: Hu
Applications: BA
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00970
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00002592-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
NB100-1919
Species: Ca, Fe, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB500-525
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-86072
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31368
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32601
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-47553PEP
Species: Hu
Applications: AC

Publications for AK3L1 Protein (NBP2-47553PEP) (0)

There are no publications for AK3L1 Protein (NBP2-47553PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AK3L1 Protein (NBP2-47553PEP) (0)

There are no reviews for AK3L1 Protein (NBP2-47553PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AK3L1 Protein (NBP2-47553PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AK3L1 Products

Research Areas for AK3L1 Protein (NBP2-47553PEP)

Find related products by research area.

Blogs on AK3L1

There are no specific blogs for AK3L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AK3L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AK4