AK3L1 Antibody

Images

 
Western Blot: AK3L1 Antibody [H00000205-B02P] - Analysis of AK3L1 expression in human liver.
Immunocytochemistry/ Immunofluorescence: AK3L1 Antibody [H00000205-B02P] - Analysis of purified antibody to AK3L1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: AK3L1 Antibody [H00000205-B02P] - Analysis of AK3L1 expression in transfected 293T cell line by AK3L1 polyclonal antibody. Lane 1: AK3L1 transfected lysate(24.53 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AK3L1 Antibody Summary

Immunogen
AK3L1 (NP_001002921, 1 a.a. - 223 a.a.) full-length human protein. MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
AK4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AK3L1 Antibody

  • adenylate kinase 3
  • adenylate kinase 3-like 1
  • Adenylate kinase 3-like
  • adenylate kinase 4
  • AK3adenylate kinase isoenzyme 4, mitochondrial
  • AK3L1
  • AK3L2
  • ATP-AMP transphosphorylase
  • EC 2.7.4
  • EC 2.7.4.3
  • GTP:AMP phosphotransferase
  • MGC166959
  • mitochondrial adenylate kinase-3
  • nucleoside-triphosphate-adenylate kinase

Background

This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86043
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02978
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00970
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-86072
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AK3L1 Antibody (H00000205-B02P) (0)

There are no publications for AK3L1 Antibody (H00000205-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AK3L1 Antibody (H00000205-B02P) (0)

There are no reviews for AK3L1 Antibody (H00000205-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AK3L1 Antibody (H00000205-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AK3L1 Products

Bioinformatics Tool for AK3L1 Antibody (H00000205-B02P)

Discover related pathways, diseases and genes to AK3L1 Antibody (H00000205-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AK3L1 Antibody (H00000205-B02P)

Discover more about diseases related to AK3L1 Antibody (H00000205-B02P).
 

Pathways for AK3L1 Antibody (H00000205-B02P)

View related products by pathway.

PTMs for AK3L1 Antibody (H00000205-B02P)

Learn more about PTMs related to AK3L1 Antibody (H00000205-B02P).
 

Research Areas for AK3L1 Antibody (H00000205-B02P)

Find related products by research area.

Blogs on AK3L1

There are no specific blogs for AK3L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AK3L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AK4
Uniprot