AK3 Antibody (1D2) - Azide and BSA Free

Western Blot: AK3 Antibody (1D2) [H00050808-M01] - AK3 monoclonal antibody (M01), clone 1D2 Analysis of AK3 expression in HepG2.

Western Blot: AK3 Antibody (1D2) [H00050808-M01] - Analysis of AK3 expression in transfected 293T cell line by AK3 monoclonal antibody (M01), clone 1D2.Lane 1: AK3 transfected lysate(25.6 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: AK3 Antibody (1D2) [H00050808-M01] - Detection limit for recombinant GST tagged AK3 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AK3 Antibody (1D2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse AK3 Antibody (1D2) - Azide and BSA Free (H00050808-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: AK3 (NP_057366, 25 a.a. ~ 86 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYS
• Specificity: AK3 - adenylate kinase 3
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: AK3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AK3 Antibody (1D2) - Azide and BSA Free

• Adenylate kinase 3 alpha-like 1
• adenylate kinase 3 like 1
• Adenylate kinase 3
• adenylate kinase 3adenylate kinase 6
• AK 3
• AK3
• AK3L1
• AK6
• AKL3L
• AKL3L1
• EC 2.7.4
• EC 2.7.4.10
• FIX
• GTP:AMP phosphotransferase, mitochondrial

Background

Adenylate kinase (AK; adenosine triphosphate-adenosine monophosphate [ATP-AMP] phospho-transferase, EC 2.7.4.3) is a ubiquitous monomeric enzyme involved energy metabolism of prokaryotic and eukaryotic cells. Three isozymes (AK1, AK2 and AK3) are characterized in vertebrates. AK1 is present in the cytosol of skeletal muscle, brain, and erythrocyte, while AK2 is localized in the intermembrane space of mitochondria of liver, kidney, spleen and heart. AK3, called GTP:AMP phosphotransferase, exists in the mitochondrial matrix of liver and heart. These isozymes contribute to homeostasis of the adenine nucleotide composition in the cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AK3
• Entrez:
  • 50808(Human)
• OMIM:
  • 609290(Human)
• Uniprot:
  • NP_057366(Human)