AK2 Antibody (3F1)

Images

 
ELISA: AK2 Antibody (3F1) [H00000204-M01] - Detection limit for recombinant GST tagged AK2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AK2 Antibody (3F1) Summary

Immunogen
AK2 (AAH09405, 1 a.a. - 239 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Specificity
AK2 - adenylate kinase 2 (3F1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AK2 Antibody (3F1)

  • adenylate kinase 2
  • adenylate kinase 2, mitochondrial
  • adenylate kinase isoenzyme 2, mitochondrial
  • ADK2
  • AK 2
  • ATP-AMP transphosphorylase 2
  • EC 2.7.4
  • EC 2.7.4.3

Background

Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00827
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-02978
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA

Publications for AK2 Antibody (H00000204-M01) (0)

There are no publications for AK2 Antibody (H00000204-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AK2 Antibody (H00000204-M01) (0)

There are no reviews for AK2 Antibody (H00000204-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AK2 Antibody (H00000204-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AK2 Products

Bioinformatics Tool for AK2 Antibody (H00000204-M01)

Discover related pathways, diseases and genes to AK2 Antibody (H00000204-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AK2 Antibody (H00000204-M01)

Discover more about diseases related to AK2 Antibody (H00000204-M01).
 

Pathways for AK2 Antibody (H00000204-M01)

View related products by pathway.

PTMs for AK2 Antibody (H00000204-M01)

Learn more about PTMs related to AK2 Antibody (H00000204-M01).

Blogs on AK2

There are no specific blogs for AK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AK2 Antibody (3F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol AK2
Entrez
Uniprot