AIM2 Recombinant Protein Antigen

Images

 
There are currently no images for AIM2 Recombinant Protein Antigen (NBP2-55560PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AIM2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AIM2.

Source: E. coli

Amino Acid Sequence: MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AIM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55560.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AIM2 Recombinant Protein Antigen

  • absent in melanoma 2PYHIN4
  • AIM2
  • Gm1313
  • Ifi210
  • interferon-inducible protein AIM2
  • PYHIN4

Background

AIM2 is a member of the IFI20X /IFI16 family. It plays a putative role in tumorigenic reversion and may control cell proliferation. Interferon-gamma induces expression of AIM2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
7625
Species: Mu
Applications: ELISA
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NBP1-78979
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P
NBP1-76854
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-83118
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-54899
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-38956
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-27066
Species: Hu, Mu
Applications: WB
201-LB
Species: Hu
Applications: BA
NBP2-45907
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-55560PEP
Species: Hu
Applications: AC

Publications for AIM2 Recombinant Protein Antigen (NBP2-55560PEP) (0)

There are no publications for AIM2 Recombinant Protein Antigen (NBP2-55560PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIM2 Recombinant Protein Antigen (NBP2-55560PEP) (0)

There are no reviews for AIM2 Recombinant Protein Antigen (NBP2-55560PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AIM2 Recombinant Protein Antigen (NBP2-55560PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AIM2 Products

Blogs on AIM2.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.

PAMPs and DAMPs: What is the Same and What is Different About These Molecules?
By Victoria OsinskiWhat are PAMPs and DAMPsInflammation results from stimuli signaling damage or infection. The immune system inflammatory response can be beneficial or harmful depending on the type and duration of ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AIM2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AIM2