AIF1L Antibody

Images

 
Immunohistochemistry-Paraffin: AIF1L Antibody [NBP2-32004] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AIF1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AIF1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AIF1L Protein (NBP2-32004PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AIF1L Antibody

  • allograft inflammatory factor 1-like
  • C9orf58
  • chromosome 9 open reading frame 58
  • IBA2FLJ12783
  • ionized calcium binding adapter molecule 2
  • Ionized calcium-binding adapter molecule 2
  • MGC29466

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-53093
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49672
Species: Hu
Applications: IHC
NBP2-37897
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32004
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for AIF1L Antibody (NBP2-32004) (0)

There are no publications for AIF1L Antibody (NBP2-32004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIF1L Antibody (NBP2-32004) (0)

There are no reviews for AIF1L Antibody (NBP2-32004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AIF1L Antibody (NBP2-32004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AIF1L Products

Bioinformatics Tool for AIF1L Antibody (NBP2-32004)

Discover related pathways, diseases and genes to AIF1L Antibody (NBP2-32004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on AIF1L

There are no specific blogs for AIF1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIF1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AIF1L
Uniprot