![Western Blot: AIF1L Antibody [H00083543-B01P] - Analysis of AIF1L expression in transfected 293T cell line by AIF1L polyclonal antibody. Lane 1: C9orf58 transfected lysate(16.5 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/AIF1L-Antibody-Western-Blot-H00083543-B01P-img0001.jpg "Western Blot: AIF1L Antibody [H00083543-B01P] - Analysis of AIF1L expression in transfected 293T cell line by AIF1L polyclonal antibody. Lane 1: C9orf58 transfected lysate(16.5 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse AIF1L Antibody - Azide and BSA Free (H00083543-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | C9orf58 (NP_113614, 1 a.a. - 150 a.a.) full-length human protein. MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | AIF1L |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-13112025131420.jpg)
![Immunohistochemistry CLC Antibody (138815) [Unconjugated]](https://images.novusbio.com/images2/CLC_MAB962_Immunohistochemistry_17289.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")