AIF Antibody

Product Discontinued

AIF Antibody Summary

• Immunogen: Synthetic peptides corresponding to PDCD8 The peptide sequence was selected from the C terminal of PDCD8 (NP_665812). Peptide sequence VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST.
• Predicted Species: Mouse (100%), Rat (100%), Porcine (100%), Rabbit (93%), Guinea Pig (93%), Bovine (100%), Canine (100%), Sheep (100%), Equine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AIFM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PDCD8 and was validated on Western blot.
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AIF Antibody

• AIF
• AIFapoptosis-inducing factor 1, mitochondrial
• AIFM1
• apoptosis-inducing factor, mitochondrion-associated, 1
• COXPD6
• MGC111425
• PDCD8
• PDCD8striatal apoptosis-inducing factor
• programmed cell death 8 (apoptosis-inducing factor)
• Programmed cell death protein 8

Background

AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Three alternative transcripts encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AIFM1
• Entrez:
  • 9131(Human)
  • 26926(Mouse)
  • 83533(Rat)
• Uniprot:
  • O95831-2(Human)