AICL/CLEC-2B Antibody - Azide and BSA Free Summary
| Immunogen |
CLEC2B (AAH05254, 1 a.a. - 149 a.a.) full-length human protein. MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH |
| Specificity |
CLEC2B - C-type lectin domain family 2, member B, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CLEC2B |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against transfected lysate for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for AICL/CLEC-2B Antibody - Azide and BSA Free
Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
Species: Hu
Applications: WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: WB
Publications for AICL/CLEC-2B Antibody (H00009976-B01P) (0)
There are no publications for AICL/CLEC-2B Antibody (H00009976-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AICL/CLEC-2B Antibody (H00009976-B01P) (0)
There are no reviews for AICL/CLEC-2B Antibody (H00009976-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AICL/CLEC-2B Antibody (H00009976-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AICL/CLEC-2B Products
Research Areas for AICL/CLEC-2B Antibody (H00009976-B01P)
Find related products by research area.
|
Blogs on AICL/CLEC-2B