SAH3 Antibody


Western Blot: SAH3 Antibody [NBP2-47293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: SAH3 Antibody [NBP2-47293] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human stomach shows moderate to strong membranous positivity in parietal cells.
Immunohistochemistry: SAH3 Antibody [NBP2-47293] - Staining of human stomach, upper shows strong membranous positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Analysis in human stomach and liver tissues. Corresponding AHCYL2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

SAH3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAH3 Protein (NBP2-47293PEP)
Read Publication using
NBP2-47293 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 27896923).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SAH3 Antibody

  • adenosylhomocysteinase-like 2
  • AdoHcyase 3
  • EC
  • FLJ21719
  • KIAA0828S-adenosylhomocysteine hydrolase-like 2
  • putative adenosylhomocysteinase 3
  • S-adenosylhomocysteine hydrolase-like protein 2
  • S-adenosyl-L-homocysteine hydrolase 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB

Publications for SAH3 Antibody (NBP2-47293)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for SAH3 Antibody (NBP2-47293) (0)

There are no reviews for SAH3 Antibody (NBP2-47293). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SAH3 Antibody (NBP2-47293) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SAH3 Products

Array NBP2-47293

Bioinformatics Tool for SAH3 Antibody (NBP2-47293)

Discover related pathways, diseases and genes to SAH3 Antibody (NBP2-47293). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAH3 Antibody (NBP2-47293)

Discover more about diseases related to SAH3 Antibody (NBP2-47293).

Pathways for SAH3 Antibody (NBP2-47293)

View related products by pathway.

Blogs on SAH3

There are no specific blogs for SAH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SAH3 Antibody and receive a gift card or discount.


Gene Symbol AHCYL2