AGXT Antibody - BSA Free

Immunohistochemistry-Paraffin: AGXT Antibody [NBP2-34198] - Analysis in human liver and pancreas tissues. Corresponding AGXT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP2-34198] - Staining of human endometrium, liver, pancreas and tonsil using Anti-AGXT antibody (A) NBP2-34198 shows similar protein distribution across tissues to independent antibody NBP1-89200 (B).

Immunocytochemistry/Immunofluorescence: AGXT Antibody [NBP2-34198] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP2-34198] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP2-34198] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP2-34198] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP2-34198] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGXT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGXT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AGXT Protein (NBP2-34198PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AGXT Antibody - BSA Free

• AGT1L-alanine: glyoxylate aminotransferase 1
• AGThepatic peroxisomal alanine:glyoxylate aminotransferase
• AGXT1
• alanine-glyoxylate aminotransferase
• Alanine--glyoxylate aminotransferase
• EC 2.6.1.44
• EC 2.6.1.51
• PH1
• serine:pyruvate aminotransferase
• SPATserine-pyruvate aminotransferase
• SPTserine--pyruvate aminotransferase
• TLH6

Background

AGXT, also known as Serine--pyruvate aminotransferase, is 43kDa and 392 amino acids long. AGXT is localized to the peroxisome and is only expressed in the liver. AGXT is implicated in glyoxylate detoxification and mutations in the AGXT gene have been linked with type I primary hyperoxaluria. AGXT has been shown to have interactions with AGXT2, PEX5, ALAS2, 14-3-3 epsilon and Synphilin-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGXT
• Uniprot:
  • P21549(Human)