AGTRAP Antibody (1G2) - Azide and BSA Free

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02] - AGTRAP monoclonal antibody (M02), clone 1G2 Analysis of AGTRAP expression in Hela S3 NE.

Immunohistochemistry-Paraffin: AGTRAP Antibody (1G2) [H00057085-M02] - Analysis of monoclonal antibody to AGTRAP on formalin-fixed paraffin-embedded human prostate. Antibody concentration 0.8 ug/ml.

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02] - Analysis of AGTRAP over-expressed 293 cell line, cotransfected with AGTRAP Validated Chimera RNAi ( Cat # H00057085-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AGTRAP monoclonal antibody (M02), clone 1G2 (Cat # H00057085-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02] - Analysis of AGTRAP expression in transfected 293T cell line by AGTRAP monoclonal antibody (M02), clone 1G2.Lane 1: AGTRAP transfected lysate(16.7 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: AGTRAP Antibody (1G2) [H00057085-M02] - Detection limit for recombinant GST tagged AGTRAP is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC, Mycoplasma
• Clone: 1G2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AGTRAP Antibody (1G2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse AGTRAP Antibody (1G2) - Azide and BSA Free (H00057085-M02) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: AGTRAP (NP_065083, 108 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGS
• Specificity: AGTRAP - angiotensin II receptor-associated protein
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: AGTRAP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AGTRAP Antibody (1G2) - Azide and BSA Free

• angiotensin II receptor-associated protein
• AT1 receptor-associated protein
• ATI receptor-associated protein
• MGC29646
• type I receptor-associated protein
• type-1 angiotensin II receptor-associated protein

Background

This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGTRAP
• Entrez:
  • 57085(Human)
• OMIM:
  • 608729(Human)
• Uniprot:
  • NP_065083(Human)