AGAP3 Antibody

Images

 
Immunohistochemistry-Paraffin: AGAP3 Antibody [NBP1-85685] - Staining of human Prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: AGAP3 Antibody [NBP1-85685] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: AGAP3 Antibody [NBP1-85685] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: AGAP3 Antibody [NBP1-85685] - Staining of human Duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AGAP3 Antibody [NBP1-85685] - Staining of human Skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPNREPANGTNPSAE
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AGAP3 Protein (NBP1-85685PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGAP3 Antibody

  • ANK repeat and PH domain-containing protein 3
  • ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
  • centaurin-gamma-3
  • cnt-g3
  • CRAG
  • CRAM-associated GTPase
  • CRMP (collapsin response mediator protein) associated
  • FLJ16146
  • FLJ34452
  • gamma 3
  • MR1-interacting protein
  • MRIP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16604
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-33419
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-38889
Species: Hu
Applications: IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
NBP1-89557
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00004810-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB5519
Species: Mu
Applications: CyTOF-ready, Flow, ICC
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85685
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for AGAP3 Antibody (NBP1-85685) (0)

There are no publications for AGAP3 Antibody (NBP1-85685).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGAP3 Antibody (NBP1-85685) (0)

There are no reviews for AGAP3 Antibody (NBP1-85685). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AGAP3 Antibody (NBP1-85685) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGAP3 Products

Array NBP1-85685

Bioinformatics Tool for AGAP3 Antibody (NBP1-85685)

Discover related pathways, diseases and genes to AGAP3 Antibody (NBP1-85685). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGAP3 Antibody (NBP1-85685)

Discover more about diseases related to AGAP3 Antibody (NBP1-85685).
 

Pathways for AGAP3 Antibody (NBP1-85685)

View related products by pathway.

Research Areas for AGAP3 Antibody (NBP1-85685)

Find related products by research area.

Blogs on AGAP3

There are no specific blogs for AGAP3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGAP3
Entrez
Uniprot