ADSSL1 Antibody - BSA Free

Staining of human heart muscle shows strong nuclear positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADSSL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADSSL1 Antibody - BSA Free (NBP3-25267) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ADSSL1 using the following amino acid sequence: DILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVG
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADSSL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADSSL1 Antibody - BSA Free

• adenylosuccinate synthase like 1
• adenylosuccinate synthetase isozyme 1
• Adenylosuccinate synthetase, basic isozyme
• Adenylosuccinate synthetase, muscle isozyme
• ADSL1
• AdSS 1
• ADSS1
• AMPSase 1
• EC 6.3.4.4
• FLJ38602
• IMP--aspartate ligase 1
• M-type adenylosuccinate synthetase

Background

ADSSL1 is a muscle isozyme of adenylosuccinate synthase (EC 6.3.4.4), which catalyzes the initial reaction in theconversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP) (Sun et al., 2005 (PubMed15786719)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADSSL1