Recombinant Human Adrenomedullin R/ADMR/GPR182 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Adrenomedullin R/ADMR/GPR182 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-54 of Human Adrenomedullin R/ADMR/GPR182

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GPR182
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
31.68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adrenomedullin R/ADMR/GPR182 GST (N-Term) Protein

  • 7TMR
  • ADMR
  • Adrenomedullin R
  • adrenomedullin receptor
  • AdrenomedullinR
  • AMR
  • AM-R
  • G protein-coupled receptor 182,7TMR
  • G10D
  • GAMRH
  • Gpcr22
  • GPR182
  • G-protein coupled receptor 182
  • hrhAMR
  • MB10
  • MGC34399
  • NOW

Background

ADMR - adrenomedullin receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Pm, Pm, Rb, Xp
Applications: IHC, IHC-P
AF6108
Species: Hu
Applications: IHC
NBP2-01853
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-94078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF4875
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
AF6517
Species: Hu
Applications: WB
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready, KO
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
H00011318-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Adrenomedullin R/ADMR/GPR182 Partial Recombinant Protein (H00011318-Q01) (0)

There are no publications for Adrenomedullin R/ADMR/GPR182 Partial Recombinant Protein (H00011318-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adrenomedullin R/ADMR/GPR182 Partial Recombinant Protein (H00011318-Q01) (0)

There are no reviews for Adrenomedullin R/ADMR/GPR182 Partial Recombinant Protein (H00011318-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adrenomedullin R/ADMR/GPR182 Partial Recombinant Protein (H00011318-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Adrenomedullin R/ADMR/GPR182 Products

Bioinformatics Tool for Adrenomedullin R/ADMR/GPR182 Partial Recombinant Protein (H00011318-Q01)

Discover related pathways, diseases and genes to Adrenomedullin R/ADMR/GPR182 Partial Recombinant Protein (H00011318-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Adrenomedullin R/ADMR/GPR182 Partial Recombinant Protein (H00011318-Q01)

Find related products by research area.

Blogs on Adrenomedullin R/ADMR/GPR182

There are no specific blogs for Adrenomedullin R/ADMR/GPR182, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Adrenomedullin R/ADMR/GPR182 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR182