ADP-Sugar Pyrophosphatase/NUDT5 Antibody

Images

 
Western Blot: ADP-Sugar Pyrophosphatase/NUDT5 Antibody [NBP1-83131] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ADP-Sugar Pyrophosphatase/NUDT5 Antibody [NBP1-83131] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: ADP-Sugar Pyrophosphatase/NUDT5 Antibody [NBP1-83131] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Western Blot: ADP-Sugar Pyrophosphatase/NUDT5 Antibody [NBP1-83131] - Lane 1: Marker (kDa) 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADP-Sugar Pyrophosphatase/NUDT5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADP-Sugar Pyrophosphatase/NUDT5 Antibody

  • EC 3.6.1.-
  • EC 3.6.1.13
  • hYSAH1
  • nucleoside diphosphate linked moiety X-type motif 5
  • Nucleoside diphosphate-linked moiety X motif 5
  • nudix (nucleoside diphosphate linked moiety X)-type motif 5
  • Nudix motif 5
  • NUDT5
  • YSA1
  • YSA1H
  • YSA1HADP-sugar pyrophosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-109
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF1585
Species: Hu
Applications: WB, IP
NBP2-01072
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-88835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-57629
Species: Hu
Applications: ICC/IF
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS

Publications for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131) (0)

There are no publications for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131) (0)

There are no reviews for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADP-Sugar Pyrophosphatase/NUDT5 Products

Bioinformatics Tool for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131)

Discover related pathways, diseases and genes to ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131)

Discover more about diseases related to ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131).
 

Pathways for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131)

View related products by pathway.

PTMs for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131)

Learn more about PTMs related to ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131).
 

Research Areas for ADP-Sugar Pyrophosphatase/NUDT5 Antibody (NBP1-83131)

Find related products by research area.

Blogs on ADP-Sugar Pyrophosphatase/NUDT5

There are no specific blogs for ADP-Sugar Pyrophosphatase/NUDT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADP-Sugar Pyrophosphatase/NUDT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT5
Entrez