ADNP Antibody

Images

 
Western Blot: ADNP Antibody [NBP1-89236] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: ADNP Antibody [NBP1-89236] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human stomach shows strong nuclear and moderate cytoplasmic positivity in glandular cells.
Western Blot: ADNP Antibody [NBP1-89236] - Analysis in human cell line SH-SY5Y.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADNP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADNP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADNP Protein (NBP1-89236PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADNP Antibody

  • Activity-dependent neuroprotective protein
  • activity-dependent neuroprotector homeobox
  • activity-dependent neuroprotector
  • ADNP homeobox 1
  • ADNP
  • ADNP1
  • ADNP1KIAA0784activity-dependent neuroprotector homeobox protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37252
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6380
Species: Mu
Applications: WB
AF1085
Species: Mu
Applications: WB, IHC, Neut
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-81468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31619
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P

Publications for ADNP Antibody (NBP1-89236) (0)

There are no publications for ADNP Antibody (NBP1-89236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADNP Antibody (NBP1-89236) (0)

There are no reviews for ADNP Antibody (NBP1-89236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADNP Antibody (NBP1-89236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADNP Products

Bioinformatics Tool for ADNP Antibody (NBP1-89236)

Discover related pathways, diseases and genes to ADNP Antibody (NBP1-89236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADNP Antibody (NBP1-89236)

Discover more about diseases related to ADNP Antibody (NBP1-89236).
 

Pathways for ADNP Antibody (NBP1-89236)

View related products by pathway.

PTMs for ADNP Antibody (NBP1-89236)

Learn more about PTMs related to ADNP Antibody (NBP1-89236).
 

Research Areas for ADNP Antibody (NBP1-89236)

Find related products by research area.

Blogs on ADNP

There are no specific blogs for ADNP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADNP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADNP
Entrez