ADI1 Antibody - BSA Free

Immunohistochemistry: ADI1 Antibody [NBP2-38251] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Simple Western: ADI1 Antibody [NBP2-38251] - Simple Western lane view shows a specific band for ADI1 in 0.2 mg/ml of HepG2 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: ADI1 Antibody [NBP2-38251] - Electropherogram image of the corresponding Simple Western lane view. ADI1 antibody was used at 1:25 dilution on HepG2 lysate(s) respectively.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADI1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADI1 Antibody - BSA Free (NBP2-38251) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADI1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Simple western :25 dilution, extenal validation.
  See Simple Western Antibody Database for Simple Western validation: Tested in HepG2 lysate, separated by Size, antibody dilution of 1:25, apparent MW was 26 kDa
• Control Peptide:

  ADI1 Protein (NBP2-38251PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ADI1 Antibody - BSA Free

• 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
• Acireductone dioxygenase (Ni(2+)-requiring)
• acireductone dioxygenase 1
• APL1
• ARDsubmergence induced protein 2
• EC 1.13.11.53
• FLJ10913
• HMFT1638
• membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1
• Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1
• MTCBP1
• MTCBP-1
• Ni-ARD
• SIPLMT1-MMP cytoplasmic tail-binding protein-1
• Submergence-induced protein 2 homolog

Background

ADI1 encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. A pseudogene that is located on chromosome 20 has been defined for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADI1
• Uniprot:
  • Q9BV57(Human)