Adenylate Kinase 1 Antibody (3G8-1B11) Summary
Immunogen |
AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK |
Specificity |
AK1 - adenylate kinase 1 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
AK1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Adenylate Kinase 1 Antibody (3G8-1B11)
Background
Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for Adenylate Kinase 1 Antibody (H00000203-M01) (0)
There are no publications for Adenylate Kinase 1 Antibody (H00000203-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adenylate Kinase 1 Antibody (H00000203-M01) (0)
There are no reviews for Adenylate Kinase 1 Antibody (H00000203-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Adenylate Kinase 1 Antibody (H00000203-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Adenylate Kinase 1 Products
Bioinformatics Tool for Adenylate Kinase 1 Antibody (H00000203-M01)
Discover related pathways, diseases and genes to Adenylate Kinase 1 Antibody (H00000203-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Adenylate Kinase 1 Antibody (H00000203-M01)
Discover more about diseases related to Adenylate Kinase 1 Antibody (H00000203-M01).
| | Pathways for Adenylate Kinase 1 Antibody (H00000203-M01)
View related products by pathway.
|
PTMs for Adenylate Kinase 1 Antibody (H00000203-M01)
Learn more about PTMs related to Adenylate Kinase 1 Antibody (H00000203-M01).
| | Research Areas for Adenylate Kinase 1 Antibody (H00000203-M01)
Find related products by research area.
|
Blogs on Adenylate Kinase 1