Adenine Nucleotide Translocase 1 Antibody

Images

 
Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP2-83928] - Host: Rabbit. Target Name: ADT1. Sample Tissue: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adenine Nucleotide Translocase 1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Adenine Nucleotide Translocase 1. Peptide sequence: FPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Publications
Read Publication using
NBP2-83928 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adenine Nucleotide Translocase 1 Antibody

  • AAC1
  • Adenine nucleotide translocator 1
  • ADP
  • ADP/ATP translocase 1
  • ANT 1
  • ANT1adenine nucleotide translocator 1 (skeletal muscle)
  • ATP carrier protein 1
  • ATP carrier protein, heart/skeletal muscle isoform T1
  • ATP carrier protein, heart/skeletal muscle
  • heart/skeletal muscle ATP/ADP translocator
  • PEO2
  • PEO3
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4
  • Solute carrier family 25 member 4
  • T1ANT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-20393
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
NBP2-15079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-85364
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
202-IL
Species: Hu
Applications: BA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-83928
Species: Hu
Applications: WB

Publications for Adenine Nucleotide Translocase 1 Antibody (NBP2-83928)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Adenine Nucleotide Translocase 1 Antibody (NBP2-83928) (0)

There are no reviews for Adenine Nucleotide Translocase 1 Antibody (NBP2-83928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenine Nucleotide Translocase 1 Antibody (NBP2-83928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenine Nucleotide Translocase 1 Products

Bioinformatics Tool for Adenine Nucleotide Translocase 1 Antibody (NBP2-83928)

Discover related pathways, diseases and genes to Adenine Nucleotide Translocase 1 Antibody (NBP2-83928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenine Nucleotide Translocase 1 Antibody (NBP2-83928)

Discover more about diseases related to Adenine Nucleotide Translocase 1 Antibody (NBP2-83928).
 

Pathways for Adenine Nucleotide Translocase 1 Antibody (NBP2-83928)

View related products by pathway.

Research Areas for Adenine Nucleotide Translocase 1 Antibody (NBP2-83928)

Find related products by research area.

Blogs on Adenine Nucleotide Translocase 1.

New Players in the Mitophagy Game
By Christina Towers, PhD Mitochondrial turn over via the lysosome, otherwise known as mitophagy, involves engulfment of mitochondria into double membrane autophagosomes and subsequent fusion with lysosomes. Much is al...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenine Nucleotide Translocase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A4