ADAT3 Antibody - Azide and BSA Free

Western Blot: ADAT3 Antibody [H00113179-B01P] - Analysis of LOC113179 expression in transfected 293T cell line by LOC113179 polyclonal antibody. Lane 1: LOC113179 transfected lysate(38.61 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ADAT3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ADAT3 Antibody - Azide and BSA Free (H00113179-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-ADAT3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ADAT3 (NP_612431, 1 a.a. - 351 a.a.) full-length human protein. MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT
• Specificity: LOC113179 - hypothetical protein BC011824,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ADAT3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADAT3 Antibody - Azide and BSA Free

• adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae)
• FWP005
• MST121
• MSTP121
• S863-5
• TAD3
• tRNA-specific adenosine deaminase 3 homolog
• tRNA-specific adenosine deaminase-like protein 3
• tRNA-specific adenosine-34 deaminase subunit ADAT3

Background

ADAT3 may be involved in deamination of adenosine-34 to inosine in many tRNAs as a regulatory subunit (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADAT3 Antibody (H00113179-B01P)(2)

Publications using H00113179-B01P

• Jillian R, Melissa P, Jonatan H et al. Identification and rescue of a tRNA wobble inosine deficiency causing intellectual disability disorder. RNA. 2020-08-06 [PMID: 32763916]
• Ramos J, Han L, Li Y et al. Formation of tRNA wobble inosine in humans is disrupted by a millennia-old mutation causing intellectual disability. Mol Cell Biol. 2019-07-01 [PMID: 31263000]

Bioinformatics

• Gene Symbol: ADAT3
• Entrez:
  • 113179(Human)
• Uniprot:
  • NP_612431(Human)