ADAR Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAR Antibody [NBP3-05523] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nucleoli.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebral cortex using Anti-ADAR antibody.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human colon using Anti-ADAR antibody.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human kidney using Anti-ADAR antibody.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human liver using Anti-ADAR antibody.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebellum, endometrium, skeletal muscle and testis using Anti-ADAR antibody NBP3-05523 (A) shows similar protein distribution across tissues ...read more
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Analysis in human testis and skeletal muscle tissues using NBP3-05523 antibody. Corresponding ADAR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebellum shows strong nuclear positivity in all layers.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For ICC/IF fixation permeabilization use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ADAR Antibody

  • ADAR1DSH
  • adenosine deaminase, RNA-specific
  • DRADAP136
  • DSRADadenosine deaminase acting on RNA 1-A
  • EC 3.5.4
  • EC 3.5.4.-
  • G1P1double-stranded RNA-specific adenosine deaminase
  • IFI-4
  • IFI4dsRNA adenosine deaminase
  • interferon-induced protein 4
  • Interferon-inducible protein 4
  • K88DSRBP
  • p136,136 kDa double-stranded RNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NB100-93325
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-75510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-57558
Species: Hu, Mu
Applications: WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for ADAR Antibody (NBP3-05523) (0)

There are no publications for ADAR Antibody (NBP3-05523).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAR Antibody (NBP3-05523) (0)

There are no reviews for ADAR Antibody (NBP3-05523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAR Antibody (NBP3-05523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADAR Products

Bioinformatics Tool for ADAR Antibody (NBP3-05523)

Discover related pathways, diseases and genes to ADAR Antibody (NBP3-05523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAR Antibody (NBP3-05523)

Discover more about diseases related to ADAR Antibody (NBP3-05523).
 

Pathways for ADAR Antibody (NBP3-05523)

View related products by pathway.

PTMs for ADAR Antibody (NBP3-05523)

Learn more about PTMs related to ADAR Antibody (NBP3-05523).

Blogs on ADAR

There are no specific blogs for ADAR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAR