Home » ADAR » ADAR Antibodies » ADAR Antibody

ADAR Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ADAR Antibody [NBP3-05523] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nucleoli.
Immunocytochemistry/ Immunofluorescence: ADAR Antibody [NBP3-05523] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nucleoli.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebral cortex using Anti-ADAR antibody.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human colon using Anti-ADAR antibody.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human kidney using Anti-ADAR antibody.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human liver using Anti-ADAR antibody.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebellum, endometrium, skeletal muscle and testis using Anti-ADAR antibody NBP3-05523 (A) shows similar protein distribution across tissues ...read more
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Analysis in human testis and skeletal muscle tissues using NBP3-05523 antibody. Corresponding ADAR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebellum shows strong nuclear positivity in all layers.
Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ADAR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For ICC/IF fixation permeabilization use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ADAR Antibody

  • ADAR1DSH
  • adenosine deaminase, RNA-specific
  • DRADAP136
  • DSRADadenosine deaminase acting on RNA 1-A
  • EC 3.5.4
  • EC 3.5.4.-
  • G1P1double-stranded RNA-specific adenosine deaminase
  • IFI-4
  • IFI4dsRNA adenosine deaminase
  • interferon-induced protein 4
  • Interferon-inducible protein 4
  • K88DSRBP
  • p136,136 kDa double-stranded RNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human duodenum, small intestine, stomach and testis using Anti-Adenosine Deaminase/ADA antibody NBP1-87404 (A) shows similar protein distribution across tissues to independent antibody NBP1-90361 (B).
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in human duodenum and testis tissues using NBP1-87404 antibody. Corresponding Adenosine Deaminase/ADA RNA-seq data are presented for the same tissues.
Western Blot: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Recombinant Human
RED1 GST (N-Term) Pro ...
H00000104-P01
SDS-Page: Recombinant Human RED1 Protein [H00000104-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Publication)
Species: Hu
NUP98 Antibody
NB100-93325
Western Blot: NUP98 Antibody [NB100-93325] - Detection of Human NUP96 on HeLa whole cell lysate using NB100-93325. NUP96 was also immunoprecipitated by rabbit anti-NUP96 antibody NB100-93326.
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IP
GluR2 Antibody
(JU20-43)
NBP2-75510
Immunocytochemistry/Immunofluorescence: GluR2 Antibody (JU20-43) [NBP2-75510] - Staining GluR2 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: GluR2 Antibody (JU20-43) [NBP2-75510] - Analysis of paraffin-embedded mouse brain tissue using anti-GluR2 antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: GluR2 Antibody (JU20-43) [NBP2-75510] - Staining GluR2 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
PKLR Antibody
[Unconjugated]
AF8519
Western blot shows lysates of human liver tissue, mouse liver tissue, and rat liver tissue. PVDF membrane was probed with 1:1000 dilution of Rabbit Anti-Human/Mouse/Rat PKLR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8519) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for PKLR at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
PKR Antibody
NBP1-77266
Western Blot: PKR Antibody [NBP1-77266] - WB Validation of PKR in Human Cell Lines. Antibodies: PKR. Secondary: Goat anti-rabbit IgG HRP conjugate.
Immunohistochemistry-Paraffin: PKR Antibody [NBP1-77266] - Staining of mouse lung tissue with antibody at 5 ug/mL.
Western Blot: PKR Antibody [NBP1-77266] - IAV via Protein Expression Profile in Cell Lines. Antibodies PKR and beta-actin. Secondary: Goat anti-rabbit IgG HRP conjugate.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(13 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
RED2 Antibody
NBP1-57558
Western Blot: RED2 Antibody [NBP1-57558] - Human Fetal Heart lysate, concentration 0.2-1 ug/ml.
(1 Publication)
Species: Hu, Mu
Applications: WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IFN-alpha 1 Antibody [NBP2-75930] - analysis of paraffin-embedded mouse brain tissue tissue using anti-IFNA1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
CRAT Antibody
NBP1-86616
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Species: Hu
Applications: WB, IHC, IHC-P
PGPEP-1 Antibody
AF6278
Western blot shows lysates of LNCaP human prostate cancer cell line, JAR human choriocarcinoma cell line, NTera‑2 human testicular embryonic carcinoma cell line, Neuro‑2A mouse neuroblastoma cell line, and human brain (cortex) tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human PGPEP‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6278) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PGPEP‑1 at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
BMP-1/PCP Antibody
[Unconjugated]
AF1927
Western blot shows 25 ng of Recombinant Human BMP‑1/PCP (Catalog # 1927-ZN), Recombinant Human TLL-2, Recombinant Human/Mouse/Rat BMP‑2 (Catalog # 355-BM), Recombinant Human BMP‑3 (Catalog # 113-BP), Recombinant Human BMP‑3b/GDF‑10 (Catalog # 1543-BP), Recombinant Human BMP‑4 (Catalog # 314-BP), Recombinant Human BMP‑5 (Catalog # 615-BMC), Recombinant Human BMP‑6 (Catalog # 507-BP), Recombinant Human BMP‑7 (Catalog # 354-BP), Recombinant Human BMP‑8a (Catalog # 1073-BP), Recombinant Human BMP‑8b (Catalog # 9316-BP), Recombinant Human BMP‑9 (Catalog # 3209-BP), Recombinant Human BMP‑10 (Catalog # 2926-BP) and Recombinant Human BMP‑15/GDF‑9B (Catalog # 5096-BM). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human BMP‑1/PCP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1927) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for BMP‑1/PCP at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Western blot shows 25 ng of Recombinant Human BMP‑1/PCP (Catalog # 1927-ZN), Recombinant Human TLL-2, Recombinant Human Meprin  alpha  Subunit/MEP1A (Catalog # 3220-ZN), Recombinant Human Meprin  beta Subunit/MEP1B (Catalog # 2895-ZN), Recombinant Human Ovastacin, Recombinant Human ADAM10 (Catalog # 936-AD), Recombinant Human ADAMTS4 (Catalog # 4307-AD), and Recombinant Human MMP‑1 (Catalog # 901-MP). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human BMP‑1/PCP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1927) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for BMP‑1/PCP at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
(5 Publications)
Species: Hu
Applications: WB, IP, ICC
Lysosomal Pro-X
Carboxypeptidase/PRCP ...
AF7164
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Lysosomal Pro‑X Carboxypeptidase/PRCP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7164) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Lysosomal Pro‑X Carboxypeptidase/PRCP at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Dishevelled-1
Antibody
NBP2-24648
Western Blot: Dishevelled-1 Antibody [NBP2-24648] - Analysis of Dishevelled-1 in Raji cell lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Hu, Mu, Rt, Pm
Applications: WB
mGluR2/3 Antibody
NB300-124
Western Blot: metabotropic Glutamate Receptor 2/3 Antibody [NB300-124] - Western blot of 10 ug of rat hippocampal lysate showing the specific immunolabeling of the ~110k monomer and the ~220k dimer of mGluR2 and mGluR3.
Western Blot: metabotropic Glutamate Receptor 2/3 Antibody [NB300-124] - Western blot of 10 ug of HEK 293 cells expression. As shown in the autoradiograph, the mGluR2/3 antibody recognizes both the ~110k monomer and the ~220k dimer of mGluR2 (Lane A) and mGluR3 (Lane B). Also shown is the specific immunolabeling of the monomer
Western Blot: metabotropic Glutamate Receptor 2/3 Antibody [NB300-124] - Specificity of mGluR2/3 (NB 300-124) in rat tissue lysate.
(4 Publications)
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Wnt-1 Antibody
(10C8)
NBP1-51575
Western Blot: Wnt-1 Antibody (10C8) [NBP1-51575] - Analysis using WNT1 mouse mAb against NIH/3T3 (1), 3T3L1 (2) and Hela (3) cell lysate.
Immunocytochemistry/Immunofluorescence: Wnt-1 Antibody (10C8) [NBP1-51575] - Confocal immunofluorescence analysis of Hela (left) and 3T3-L1 (right) cells using WNT1 mouse mAb (green). Red: Actin filaments have been labeled with DY-554 phalloidin. Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: Wnt-1 Antibody (10C8) [NBP1-51575] - Analysis of human LAdrenal tissues using WNT1 mouse mAb.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for ADAR Antibody (NBP3-05523) (0)

There are no publications for ADAR Antibody (NBP3-05523).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAR Antibody (NBP3-05523) (0)

There are no reviews for ADAR Antibody (NBP3-05523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAR Antibody (NBP3-05523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ADAR Products

Bioinformatics Tool for ADAR Antibody (NBP3-05523)

Discover related pathways, diseases and genes to ADAR Antibody (NBP3-05523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAR Antibody (NBP3-05523)

Discover more about diseases related to ADAR Antibody (NBP3-05523).
 

Pathways for ADAR Antibody (NBP3-05523)

View related products by pathway.

PTMs for ADAR Antibody (NBP3-05523)

Learn more about PTMs related to ADAR Antibody (NBP3-05523).

Blogs on ADAR

There are no specific blogs for ADAR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAR Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ADAR