ADAMTS5 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADAMTS5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ADAMTS5 Antibody - BSA Free
Background
ADAMTS5, also known as aggrecanase-2, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan. The protein contains a signal sequence, a prodomain with both a potential cysteine switch and a furin cleavage site, a metalloproteinase domain with a conserved zinc-binding motif and a 'met turn,' a disintegrin-like domain, and a spacer region between a thrombospondin type 1 motif and thrombospondin submotif. At least four transcript variants have been reported. ADAMTS5 has been implicated in inflammatory joint diseases. ADAMTS5 expression has been documented in a range of normal human tissues. ESTs have been isolated from human tissue libraries, including normal breast, embryo and heart and cancerous placenta and uterus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: InhibAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Species: Hu, Mu
Applications: COMET, IHC, IHC-P, mIF
Species: Mu
Applications: ELISA
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC
Publications for ADAMTS5 Antibody (NBP1-89247) (0)
There are no publications for ADAMTS5 Antibody (NBP1-89247).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAMTS5 Antibody (NBP1-89247) (0)
There are no reviews for ADAMTS5 Antibody (NBP1-89247).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ADAMTS5 Antibody (NBP1-89247) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADAMTS5 Products
Research Areas for ADAMTS5 Antibody (NBP1-89247)
Find related products by research area.
|
Blogs on ADAMTS5