ADAMTS19 Antibody

Images

 
Immunohistochemistry: ADAMTS19 Antibody [NBP2-31627] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTS19 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EPLNDTMAITGHPHRVYRQKRSMEEKVTEKSALHSHYCGIISDKGRPRSRKIAESGRGKRYSYKLPQEYNIETVVVADPAMVSYHGAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTS19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAMTS19 Protein (NBP2-31627PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAMTS19 Antibody

  • A disintegrin and metalloproteinase with thrombospondin motifs 19
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 19
  • ADAM metallopeptidase with thrombospondin type 1 motif, 19
  • ADAM-TS 19
  • ADAM-TS19
  • ADAMTS-19
  • EC 3.4.24.-
  • FLJ16042

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4245
Species: Hu
Applications: WB, IP
NBP1-90657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81299
Species: Hu
Applications: IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
5096-BM
Species: Hu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS1436
Species: Hu
Applications: IHC-P
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NBP2-05595
Species: Hu
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NBP2-05605
Species: Hu
NBP2-31627
Species: Hu
Applications: IHC, IHC-P

Publications for ADAMTS19 Antibody (NBP2-31627) (0)

There are no publications for ADAMTS19 Antibody (NBP2-31627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS19 Antibody (NBP2-31627) (0)

There are no reviews for ADAMTS19 Antibody (NBP2-31627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ADAMTS19 Antibody (NBP2-31627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAMTS19 Products

Bioinformatics Tool for ADAMTS19 Antibody (NBP2-31627)

Discover related pathways, diseases and genes to ADAMTS19 Antibody (NBP2-31627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS19 Antibody (NBP2-31627)

Discover more about diseases related to ADAMTS19 Antibody (NBP2-31627).
 

Pathways for ADAMTS19 Antibody (NBP2-31627)

View related products by pathway.

Blogs on ADAMTS19

There are no specific blogs for ADAMTS19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTS19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS19
Uniprot