ADAM23 Antibody

Images

 
Western Blot: ADAM23 Antibody [NBP1-69016] - Mouse Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAM23 Antibody Summary

Immunogen
Synthetic peptides corresponding to Adam23 (a disintegrin and metallopeptidase domain 23) The peptide sequence was selected from the C terminal of Adam23. Peptide sequence NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Adam23 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADAM23 Antibody

  • a disintegrin and metalloproteinase domain 23
  • ADAM metallopeptidase domain 23
  • ADAM23
  • disintegrin and metalloproteinase domain-containing protein 23
  • MDC3
  • MDC-3
  • MDC3ADAM 23
  • MDC-L
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3

Background

Adam23 may play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB49081
Species: Hu
Applications: WB, IP
H00004185-M01
Species: Hu
Applications: WB, ELISA
AF949
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
930-ADB
Species: Hu
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55995
Species: Hu
Applications: ICC/IF
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP1-80638
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-69016
Species: Mu
Applications: WB

Publications for ADAM23 Antibody (NBP1-69016) (0)

There are no publications for ADAM23 Antibody (NBP1-69016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM23 Antibody (NBP1-69016) (0)

There are no reviews for ADAM23 Antibody (NBP1-69016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM23 Antibody (NBP1-69016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAM23 Products

Bioinformatics Tool for ADAM23 Antibody (NBP1-69016)

Discover related pathways, diseases and genes to ADAM23 Antibody (NBP1-69016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM23 Antibody (NBP1-69016)

Discover more about diseases related to ADAM23 Antibody (NBP1-69016).
 

Pathways for ADAM23 Antibody (NBP1-69016)

View related products by pathway.

PTMs for ADAM23 Antibody (NBP1-69016)

Learn more about PTMs related to ADAM23 Antibody (NBP1-69016).

Blogs on ADAM23

There are no specific blogs for ADAM23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM23
Entrez
Uniprot