ADAM15 Antibody (4T4X10)

Western Blot: ADAM15 Antibody (4T4X10) [NBP3-16642] - Western blot analysis of extracts of HCT116 cells, using ADAM15 Rabbit mAb (NBP3-16642) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] - Confocal imaging of paraffin-embedded mouse large intestine using ADAM15 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunofluorescence analysis of paraffin-embedded rat rectum using ADAM15 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] - Confocal imaging of paraffin-embedded Human colon cancer using ADAM15 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 4T4X10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ADAM15 Antibody (4T4X10) Summary

• Description: Novus Biologicals Rabbit ADAM15 Antibody (4T4X10) (NBP3-16642) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ADAM15 (Q13444). RHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ADAM15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADAM15 Antibody (4T4X10)

• ADAM 15
• ADAM metallopeptidase domain 15
• ADAM15
• disintegrin-like, and cysteine-rich protein 15
• EC 3.4.24
• MDC15
• MDC-15
• Metargidin

Background

ADAM15 is encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAM15