ACYP2 Antibody

Images

 
Western Blot: ACYP2 Antibody [NBP1-86308] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ACYP2 Antibody [NBP1-86308] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ACYP2 Antibody [NBP1-86308] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACYP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVGSPSSRIDRTNFSNE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACYP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACYP2 Protein (NBP1-86308PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACYP2 Antibody

  • acylphosphatase 2, muscle type
  • acylphosphatase-2
  • Acylphosphate phosphohydrolase 2
  • ACYM
  • ACYPmuscle type isozyme
  • EC 3.6.1.7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-30666
Species: Hu
Applications: IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-85187
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30666
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-58807
Species: Hu
Applications: WB, ICC/IF
NBP1-57681
Species: Hu
Applications: WB
NBP1-92462
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-01291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86308
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACYP2 Antibody (NBP1-86308) (0)

There are no publications for ACYP2 Antibody (NBP1-86308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACYP2 Antibody (NBP1-86308) (0)

There are no reviews for ACYP2 Antibody (NBP1-86308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACYP2 Antibody (NBP1-86308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACYP2 Products

Bioinformatics Tool for ACYP2 Antibody (NBP1-86308)

Discover related pathways, diseases and genes to ACYP2 Antibody (NBP1-86308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACYP2 Antibody (NBP1-86308)

Discover more about diseases related to ACYP2 Antibody (NBP1-86308).
 

Pathways for ACYP2 Antibody (NBP1-86308)

View related products by pathway.

Blogs on ACYP2

There are no specific blogs for ACYP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACYP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACYP2
Entrez
Uniprot