FARS2 Antibody - BSA Free

Western Blot: FARS2 Antibody [NBP1-85187] - Analysis in control (vector only transfected HEK293T lysate) and FARS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: FARS2 Antibody [NBP1-85187] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.

Immunohistochemistry-Paraffin: FARS2 Antibody [NBP1-85187] - Staining of human kidney shows strong cytoplasmic and extra cellular positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FARS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FARS2 Antibody - BSA Free (NBP1-85187) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAEND
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FARS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FARS2 Protein (NBP1-85187PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FARS2 Antibody - BSA Free

• dJ236A3.1
• dJ520B18.2 (FARS1 (phenylalanine-tRNA synthetase))
• dJ520B18.2
• EC 6.1.1
• EC 6.1.1.20
• FARS1dJ236A3.1 (phenylalanine-tRNA synthetase)
• HSPC320
• phenylalanine translase
• phenylalanine tRNA ligase 2, mitochondrial
• Phenylalanine--tRNA ligase
• phenylalanine-tRNA synthetase 1 (mitochondrial)
• phenylalanine-tRNA synthetase 2 (mitochondrial)
• phenylalanyl-tRNA synthetase 2, mitochondrial
• phenylalanyl-tRNA synthetase, mitochondrial
• PheRS

Background

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FARS2