Recombinant Human actin, gamma 2 Protein

Images

 
SDS-Page: Recombinant Human actin, gamma 2 Protein [H00000072-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human actin, gamma 2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-376 of Human ACTG2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ACTG2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human actin, gamma 2 Protein

  • ACT
  • ACTA3alpha-actin 3
  • ACTE
  • actin, gamma 2, smooth muscle, enteric
  • actin, gamma-enteric smooth muscle
  • ACTL3
  • ACTSGactin-like protein
  • alpha-actin-3
  • gamma-2-actin
  • smooth muscle gamma actin
  • Smooth muscle gamma-actin

Background

Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 2, encoded by this gene, is a smooth muscle actin found in enteric tissues. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2898
Species: Mu
Applications: WB, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5739
Species: Hu, Mu, Rt
Applications: WB
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for actin, gamma 2 Recombinant Protein (H00000072-P02) (0)

There are no publications for actin, gamma 2 Recombinant Protein (H00000072-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for actin, gamma 2 Recombinant Protein (H00000072-P02) (0)

There are no reviews for actin, gamma 2 Recombinant Protein (H00000072-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for actin, gamma 2 Recombinant Protein (H00000072-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional actin, gamma 2 Products

Bioinformatics Tool for actin, gamma 2 Recombinant Protein (H00000072-P02)

Discover related pathways, diseases and genes to actin, gamma 2 Recombinant Protein (H00000072-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for actin, gamma 2 Recombinant Protein (H00000072-P02)

Discover more about diseases related to actin, gamma 2 Recombinant Protein (H00000072-P02).
 

Pathways for actin, gamma 2 Recombinant Protein (H00000072-P02)

View related products by pathway.

Blogs on actin, gamma 2

There are no specific blogs for actin, gamma 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human actin, gamma 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTG2