ACSM3 Antibody - BSA Free

Immunohistochemistry: ACSM3 Antibody [NBP1-87098] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACSM3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACSM3 Antibody - BSA Free (NBP1-87098) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACSM3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ACSM3 Protein (NBP1-87098PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACSM3 Antibody - BSA Free

• acyl-CoA synthetase medium-chain family member 3Protein SA homolog
• acyl-coenzyme A synthetase ACSM3, mitochondrial
• Butyrate--CoA ligase 3
• Butyryl-coenzyme A synthetase 3
• EC 6.2.1
• Middle-chain acyl-CoA synthetase 3
• SA (rat hypertension-associated) homolog
• SA hypertension-associated homolog (rat)
• SA hypertension-associated homolog
• SA
• SAH
• SAHEC 6.2.1.2

Background

ACSM3 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACSM3
• Entrez:
  • 6296(Human)
• Uniprot:
  • Q53FZ2(Human)