ACSM3 Antibody

Images

 
Immunohistochemistry: ACSM3 Antibody [NBP1-87098] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACSM3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACSM3 Protein (NBP1-87098PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACSM3 Antibody

  • acyl-CoA synthetase medium-chain family member 3Protein SA homolog
  • acyl-coenzyme A synthetase ACSM3, mitochondrial
  • Butyrate--CoA ligase 3
  • Butyryl-coenzyme A synthetase 3
  • EC 6.2.1
  • Middle-chain acyl-CoA synthetase 3
  • SA (rat hypertension-associated) homolog
  • SA hypertension-associated homolog (rat)
  • SA hypertension-associated homolog
  • SA
  • SAH
  • SAHEC 6.2.1.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6466
Species: Hu
Applications: WB
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6526
Species: Hu
Applications: WB
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ACSM3 Antibody (NBP1-87098) (0)

There are no publications for ACSM3 Antibody (NBP1-87098).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSM3 Antibody (NBP1-87098) (0)

There are no reviews for ACSM3 Antibody (NBP1-87098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACSM3 Antibody (NBP1-87098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSM3 Products

Bioinformatics Tool for ACSM3 Antibody (NBP1-87098)

Discover related pathways, diseases and genes to ACSM3 Antibody (NBP1-87098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSM3 Antibody (NBP1-87098)

Discover more about diseases related to ACSM3 Antibody (NBP1-87098).
 

Pathways for ACSM3 Antibody (NBP1-87098)

View related products by pathway.

PTMs for ACSM3 Antibody (NBP1-87098)

Learn more about PTMs related to ACSM3 Antibody (NBP1-87098).

Blogs on ACSM3

There are no specific blogs for ACSM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSM3
Entrez
Uniprot