ACSM3 Antibody

Images

 
Western Blot: ACSM3 Antibody [NBP1-74275] - Placenta Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

ACSM3 Antibody Summary

Immunogen
Synthetic peptides corresponding to thetase medium chain family member 3 Antibody against the N terminal of ACSM3. Immunizing peptide sequence SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR.
Clonality
Polyclonal
Host
Rabbit
Gene
ACSM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACSM3 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACSM3 Antibody

  • acyl-CoA synthetase medium-chain family member 3Protein SA homolog
  • acyl-coenzyme A synthetase ACSM3, mitochondrial
  • Butyrate--CoA ligase 3
  • Butyryl-coenzyme A synthetase 3
  • EC 6.2.1
  • Middle-chain acyl-CoA synthetase 3
  • SA (rat hypertension-associated) homolog
  • SA hypertension-associated homolog (rat)
  • SA hypertension-associated homolog
  • SA
  • SAH
  • SAHEC 6.2.1.2

Background

Q53FZ2 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). It acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48817
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6526
Species: Hu
Applications: WB
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po, Ze
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF4068
Species: Hu
Applications: WB, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004524-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ACSM3 Antibody (NBP1-74275) (0)

There are no publications for ACSM3 Antibody (NBP1-74275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSM3 Antibody (NBP1-74275) (0)

There are no reviews for ACSM3 Antibody (NBP1-74275). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSM3 Antibody (NBP1-74275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSM3 Antibody Products

Related Products by Gene

Bioinformatics Tool for ACSM3 Antibody (NBP1-74275)

Discover related pathways, diseases and genes to ACSM3 Antibody (NBP1-74275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSM3 Antibody (NBP1-74275)

Discover more about diseases related to ACSM3 Antibody (NBP1-74275).
 

Pathways for ACSM3 Antibody (NBP1-74275)

View related products by pathway.

PTMs for ACSM3 Antibody (NBP1-74275)

Learn more about PTMs related to ACSM3 Antibody (NBP1-74275).

Blogs on ACSM3

There are no specific blogs for ACSM3, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ACSM3
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-74275 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought