ACSM3 Antibody (NBP1-74275)


Western Blot: ACSM3 Antibody [NBP1-74275] - Placenta Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ACSM3 Antibody Summary

Synthetic peptides corresponding to thetase medium chain family member 3 Antibody against the N terminal of ACSM3. Immunizing peptide sequence SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACSM3 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACSM3 Antibody

  • acyl-CoA synthetase medium-chain family member 3Protein SA homolog
  • acyl-coenzyme A synthetase ACSM3, mitochondrial
  • Butyrate--CoA ligase 3
  • Butyryl-coenzyme A synthetase 3
  • EC 6.2.1
  • Middle-chain acyl-CoA synthetase 3
  • SA (rat hypertension-associated) homolog
  • SA hypertension-associated homolog (rat)
  • SA hypertension-associated homolog
  • SA
  • SAH


Q53FZ2 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). It acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ACSM3 Antibody (NBP1-74275) (0)

There are no publications for ACSM3 Antibody (NBP1-74275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSM3 Antibody (NBP1-74275) (0)

There are no reviews for ACSM3 Antibody (NBP1-74275). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSM3 Antibody (NBP1-74275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ACSM3 Antibody Products

Related Products by Gene

Bioinformatics Tool for ACSM3 Antibody (NBP1-74275)

Discover related pathways, diseases and genes to ACSM3 Antibody (NBP1-74275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSM3 Antibody (NBP1-74275)

Discover more about diseases related to ACSM3 Antibody (NBP1-74275).

Pathways for ACSM3 Antibody (NBP1-74275)

View related products by pathway.

PTMs for ACSM3 Antibody (NBP1-74275)

Learn more about PTMs related to ACSM3 Antibody (NBP1-74275).

Blogs on ACSM3

There are no specific blogs for ACSM3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACSM3 Antibody and receive a gift card or discount.


Gene Symbol ACSM3

Customers Who Bought This Also Bought