ACSL5 Recombinant Protein Antigen

Images

 
There are currently no images for ACSL5 Recombinant Protein Antigen (NBP2-52899PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACSL5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACSL5.

Source: E. coli

Amino Acid Sequence: VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACSL5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52899.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACSL5 Recombinant Protein Antigen

  • ACS2
  • ACS5FACL5 for fatty acid coenzyme A ligase 5
  • acyl-CoA synthetase long-chain family member 5
  • EC 6.2.1
  • EC 6.2.1.3
  • FACL5fatty acid coenzyme A ligase 5
  • fatty-acid-Coenzyme A ligase, long-chain 5
  • LACS 5
  • Long-chain acyl-CoA synthetase 5
  • long-chain fatty acid coenzyme A ligase 5
  • long-chain-fatty-acid--CoA ligase 5

Background

Long-chain-fatty-acid--CoA ligase 5, or ACSL5, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in both synthesis of cellular lipids and degradation via beta-oxidation. Like other isozymes of this family, ALCS5 converts free long-chain fatty acids into fatty acyl-CoA esters. Specifically, ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage.

This isozyme is highly expressed in uterus and spleen, and in trace amounts are found in normal brain. It also has significantly increased expression in malignant gliomas, where the protein functions in mediating fatty acid-induced glioma cell growth. Therefore, ALCS5 is thought to have a key role in the survival of glioma cells and may be a potential target for novel cancer treatments. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-99585
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92089
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15252
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89269
Species: Hu
Applications: IHC,  IHC-P
NBP1-90265
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
MAB6898
Species: Hu, Mu
Applications: WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for ACSL5 Recombinant Protein Antigen (NBP2-52899PEP) (0)

There are no publications for ACSL5 Recombinant Protein Antigen (NBP2-52899PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSL5 Recombinant Protein Antigen (NBP2-52899PEP) (0)

There are no reviews for ACSL5 Recombinant Protein Antigen (NBP2-52899PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACSL5 Recombinant Protein Antigen (NBP2-52899PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACSL5 Products

Research Areas for ACSL5 Recombinant Protein Antigen (NBP2-52899PEP)

Find related products by research area.

Blogs on ACSL5

There are no specific blogs for ACSL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACSL5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL5