ACSL5 Antibody [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related ACSL5 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-35416AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ACSL5 Antibody [Alexa Fluor® 700] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 500-739 of human ACSL5 (NP_057318.2).

Sequence:
GQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSL5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for ACSL5 Antibody [Alexa Fluor® 700]

  • ACS2
  • ACS5FACL5 for fatty acid coenzyme A ligase 5
  • acyl-CoA synthetase long-chain family member 5
  • EC 6.2.1
  • EC 6.2.1.3
  • FACL5fatty acid coenzyme A ligase 5
  • fatty-acid-Coenzyme A ligase, long-chain 5
  • LACS 5
  • Long-chain acyl-CoA synthetase 5
  • long-chain fatty acid coenzyme A ligase 5
  • long-chain-fatty-acid--CoA ligase 5

Background

Long-chain-fatty-acid--CoA ligase 5, or ACSL5, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in both synthesis of cellular lipids and degradation via beta-oxidation. Like other isozymes of this family, ALCS5 converts free long-chain fatty acids into fatty acyl-CoA esters. Specifically, ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage.

This isozyme is highly expressed in uterus and spleen, and in trace amounts are found in normal brain. It also has significantly increased expression in malignant gliomas, where the protein functions in mediating fatty acid-induced glioma cell growth. Therefore, ALCS5 is thought to have a key role in the survival of glioma cells and may be a potential target for novel cancer treatments. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-99585
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92089
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15252
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89269
Species: Hu
Applications: IHC,  IHC-P
NBP1-90265
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
MAB6898
Species: Hu, Mu
Applications: WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for ACSL5 Antibody (NBP3-35416AF700) (0)

There are no publications for ACSL5 Antibody (NBP3-35416AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSL5 Antibody (NBP3-35416AF700) (0)

There are no reviews for ACSL5 Antibody (NBP3-35416AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSL5 Antibody (NBP3-35416AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSL5 Products

Research Areas for ACSL5 Antibody (NBP3-35416AF700)

Find related products by research area.

Blogs on ACSL5

There are no specific blogs for ACSL5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSL5 Antibody [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL5