ACRBP Antibody - BSA Free

Western Blot: ACRBP Antibody [NBP1-85408] - Analysis in control (vector only transfected HEK293T lysate) and ACRBP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85408] - Staining in human testis and endometrium tissues using anti-ACRBP antibody. Corresponding ACRBP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85408] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85408] - Staining of human endometrium shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACRBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACRBP Antibody - BSA Free (NBP1-85408) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACRBP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ACRBP Protein (NBP1-85408PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACRBP Antibody - BSA Free

• acrosin binding protein
• acrosin-binding protein
• Cancer/testis antigen 23
• Cancer/testis antigen OY-TES-1
• CT23FLJ51160
• OY-TES-1
• proacrosin binding protein sp32
• Proacrosin-binding protein sp32
• SP32

Background

ACRBP is encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACRBP