ACPT Antibody - BSA Free

Western Blot: ACPT Antibody [NBP1-62440] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Discontinued

ACPT Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ACPT(acid phosphatase, testicular) The peptide sequence was selected from the middle region of ACPT (NP_149059). Peptide sequence TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACPT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ACPT Antibody - BSA Free

• acid phosphatase, testicular
• EC 3.1.3.2
• testicular acid phosphatase

Background

Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. ACPT has structural similarity to prostatic and lysosomal acid phosphatases.Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. The protein encoded by this gene has structural similarity to prostatic and lysosomal acid phosphatases. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACPT Antibody (NBP1-62440)(1)

Publication using NBP1-62440

• Gruper Y, Wolff ASB, Glanz L et al. Autoimmune amelogenesis imperfecta in patients with APS-1 and coeliac disease Nature 2023-11-22 [PMID: 37993717]

Bioinformatics

• Gene Symbol: ACPT
• Entrez:
  • 93650(Human)
• Uniprot:
  • Q9BZG2(Human)