ACOX2 Antibody (1A7)

Images

 
Sandwich ELISA: ACOX2 Antibody (1A7) [H00008309-M02] - Detection limit for recombinant GST tagged ACOX2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACOX2 Antibody (1A7) Summary

Immunogen
ACOX2 (NP_003491, 582 a.a. - 681 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACOX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACOX2 Antibody (1A7)

  • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase
  • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase
  • 3-alpha
  • 7-alpha
  • acyl-CoA oxidase 2, branched chain
  • acyl-Coenzyme A oxidase 2, branched chain
  • BCOX
  • BRCACOXTHCA-CoA oxidase
  • BRCOX
  • EC 1.17.99.3
  • peroxisomal acyl-coenzyme A oxidase 2,3-alpha
  • peroxisomal branched chain acyl-CoA oxidase
  • THCCox
  • Trihydroxycoprostanoyl-CoA oxidase

Background

The product of this gene belongs to the acyl-CoA oxidases family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe mental retardation and death in children.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85901
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
MAB9120
Species: Hu
Applications: ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
AF5540
Species: Mu
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
NBP2-50218
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-50212
Species: Hu, Mu, Rt, Dr, Xp
Applications: WB, ELISA, IHC

Publications for ACOX2 Antibody (H00008309-M02) (0)

There are no publications for ACOX2 Antibody (H00008309-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOX2 Antibody (H00008309-M02) (0)

There are no reviews for ACOX2 Antibody (H00008309-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOX2 Antibody (H00008309-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACOX2 Products

Bioinformatics Tool for ACOX2 Antibody (H00008309-M02)

Discover related pathways, diseases and genes to ACOX2 Antibody (H00008309-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOX2 Antibody (H00008309-M02)

Discover more about diseases related to ACOX2 Antibody (H00008309-M02).
 

Pathways for ACOX2 Antibody (H00008309-M02)

View related products by pathway.

PTMs for ACOX2 Antibody (H00008309-M02)

Learn more about PTMs related to ACOX2 Antibody (H00008309-M02).

Blogs on ACOX2

There are no specific blogs for ACOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACOX2 Antibody (1A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOX2
Uniprot