ACOT8 Antibody - Azide and BSA Free

Western Blot: ACOT8 Antibody [H00010005-B01P] - Analysis of ACOT8 expression in transfected 293T cell line by ACOT8 polyclonal antibody. Lane 1: ACOT8 transfected lysate(35.09 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: ACOT8 Antibody [H00010005-B01P] - Analysis of purified antibody to ACOT8 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: ACOT8 Antibody [H00010005-B01P] - Western Blot analysis of ACOT8 expression in human spleen.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ACOT8 Antibody - Azide and BSA Free Summary

• Immunogen: ACOT8 (NP_005460.2, 1 a.a. - 319 a.a.) full-length human protein. MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL
• Specificity: ACOT8 - acyl-CoA thioesterase 8,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ACOT8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACOT8 Antibody - Azide and BSA Free

• ACTEIII
• acyl-CoA thioesterase 8HNAACTE
• Choloyl-coenzyme A thioesterase
• EC 3.1.2.27
• hACTEIII
• HIV-Nef-associated acyl-CoA thioesterase
• hTEcholoyl-CoA hydrolase
• long-chain fatty-acyl-CoA hydrolase
• palmitoyl-CoA hydrolase
• peroxisomal acyl-CoA thioesterase 1
• peroxisomal acyl-CoA thioesterase
• Peroxisomal acyl-coenzyme A thioester hydrolase 1
• Peroxisomal long-chain acyl-CoA thioesterase 1
• PTE-1
• PTE1HIV-Nef associated acyl-CoA thioesterase
• PTE2
• PTE-2hACTE-IIIacyl-coenzyme A thioesterase 8
• Thioesterase II
• thioesterase III

Background

The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACOT8 Antibody (H00010005-B01P)(1)

Publication using H00010005-B01P

• Gondim MV, Wiltzer-Bach L, Maurer B et al. AP-2 Is the Crucial Clathrin Adaptor Protein for CD4 Downmodulation by HIV-1 Nef in Infected Primary CD4+ T Cells. J Virol 2015-12-01 [PMID: 26423947]

Bioinformatics

• Gene Symbol: ACOT8
• Entrez:
  • 10005(Human)
• Uniprot:
  • NP_005460.2(Human)