ACOT11 Antibody

Images

 
Western Blot: ACOT11 Antibody [NBP2-58936] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ACOT11 Antibody [NBP2-58936] - Staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: ACOT11 Antibody [NBP2-58936] - Staining in human duodenum and pancreas tissues using anti-ACOT11 antibody. Corresponding ACOT11 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACOT11 Antibody [NBP2-58936] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: ACOT11 Antibody [NBP2-58936] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACOT11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE
Specificity
Specificity of human ACOT11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACOT11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACOT11 Recombinant Protein Antigen (NBP2-58936PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ACOT11 Antibody

  • Acyl-CoA thioester hydrolase 11
  • acyl-CoA thioesterase 11BFIT1
  • Adipose-associated thioesterase
  • BFIT2
  • BFITDKFZp667O1916
  • Brown fat-inducible thioesterase
  • EC 3.1.2.-
  • EC 3.1.2.1
  • KIAA0707acyl-coenzyme A thioesterase 11
  • STARD14
  • START domain containing 14
  • THEAStAR-related lipid transfer (START) domain containing 14
  • THEM1
  • thioesterase superfamily member 1
  • thioesterase, adipose associated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-03605
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-57770
Species: Hu
Applications: WB
NBP2-49292
Species: Hu
Applications: IHC, IHC-P
NBP1-92448
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IHC, IP
NBP1-30448
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-80670
Species: Hu
Applications: IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58490
Species: Hu
Applications: ICC/IF
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-58936
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACOT11 Antibody (NBP2-58936) (0)

There are no publications for ACOT11 Antibody (NBP2-58936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOT11 Antibody (NBP2-58936) (0)

There are no reviews for ACOT11 Antibody (NBP2-58936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACOT11 Antibody (NBP2-58936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ACOT11 Antibody (NBP2-58936)

Discover related pathways, diseases and genes to ACOT11 Antibody (NBP2-58936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOT11 Antibody (NBP2-58936)

Discover more about diseases related to ACOT11 Antibody (NBP2-58936).
 

Pathways for ACOT11 Antibody (NBP2-58936)

View related products by pathway.

PTMs for ACOT11 Antibody (NBP2-58936)

Learn more about PTMs related to ACOT11 Antibody (NBP2-58936).
 

Research Areas for ACOT11 Antibody (NBP2-58936)

Find related products by research area.

Blogs on ACOT11

There are no specific blogs for ACOT11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACOT11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOT11