ACOT11 Antibody


Western Blot: ACOT11 Antibody [NBP2-58936] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ACOT11 Antibody [NBP2-58936] - Staining of human cell line A-431 shows localization to cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACOT11 Antibody [NBP2-58936] - Staining in human duodenum and pancreas tissues using anti-ACOT11 antibody. Corresponding ACOT11 RNA-seq data are presented for more
Immunohistochemistry-Paraffin: ACOT11 Antibody [NBP2-58936] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: ACOT11 Antibody [NBP2-58936] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ACOT11 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE
Specificity of human ACOT11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ACOT11 Antibody

  • Acyl-CoA thioester hydrolase 11
  • acyl-CoA thioesterase 11BFIT1
  • Adipose-associated thioesterase
  • BFIT2
  • BFITDKFZp667O1916
  • Brown fat-inducible thioesterase
  • EC 3.1.2.-
  • EC
  • KIAA0707acyl-coenzyme A thioesterase 11
  • STARD14
  • START domain containing 14
  • THEAStAR-related lipid transfer (START) domain containing 14
  • THEM1
  • thioesterase superfamily member 1
  • thioesterase, adipose associated


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
Species: Mu
Applications: WB, Simple Western, IHC, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACOT11 Antibody (NBP2-58936) (0)

There are no publications for ACOT11 Antibody (NBP2-58936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOT11 Antibody (NBP2-58936) (0)

There are no reviews for ACOT11 Antibody (NBP2-58936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACOT11 Antibody (NBP2-58936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ACOT11 Products

Bioinformatics Tool for ACOT11 Antibody (NBP2-58936)

Discover related pathways, diseases and genes to ACOT11 Antibody (NBP2-58936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOT11 Antibody (NBP2-58936)

Discover more about diseases related to ACOT11 Antibody (NBP2-58936).

Pathways for ACOT11 Antibody (NBP2-58936)

View related products by pathway.

PTMs for ACOT11 Antibody (NBP2-58936)

Learn more about PTMs related to ACOT11 Antibody (NBP2-58936).

Research Areas for ACOT11 Antibody (NBP2-58936)

Find related products by research area.

Blogs on ACOT11

There are no specific blogs for ACOT11, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACOT11 Antibody and receive a gift card or discount.


Gene Symbol ACOT11
COVID-19 update