ACF Antibody

Immunocytochemistry/Immunofluorescence: ACF Antibody [NBP2-33412] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human colon, kidney, liver and tonsil using Anti-A1CF antibody NBP2-33412 (A) shows similar protein distribution across tissues to independent antibody NBP1-90271 (B).

Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human tonsil shows no positivity as expected.

Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human colon shows positivity in glandular cells.

Product Discontinued

ACF Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: REIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQ
• Predicted Species: Mouse (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: A1CF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat (81%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACF Antibody

• ACF65
• ACFASPACF64
• apo-B RNA editing protein
• apobec-1 complementation factor (ACF) (ASP)
• APOBEC1 complementation factor
• APOBEC-1 stimulating protein
• APOBEC1CF
• APOBEC1-stimulating protein
• MGC163391

Background

Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Alternative splicing occurs at this locus and three full-length transcript variants, encoding three distinct isoforms, have been described. Additional splicing has been observed but the full-length nature of these variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: A1CF
• Uniprot:
  • Q9NQ94(Human)