ACD Recombinant Protein Antigen

Images

 
There are currently no images for ACD Protein (NBP2-33839PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACD.

Source: E. coli

Amino Acid Sequence: IRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33839.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACD Recombinant Protein Antigen

  • adrenocortical dysplasia homolog (mouse)
  • Pip1
  • PIP1Tint1
  • POT1 and TIN2 organizing protein
  • POT1 and TIN2-interacting protein
  • Ptop
  • PTOPTpp1
  • TIN2 interacting protein 1
  • TINT1adrenocortical dysplasia protein homolog
  • TPP1

Background

ACD encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB500-176
Species: Hu
Applications: WB
NBP2-55709
Species: Hu
Applications: ICC/IF, WB
H00009455-B01P
Species: Hu, Mu, Rt
Applications: WB
MEP00B
Species: Mu
Applications: ELISA
NBP1-47914
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
664-LI
Species: Hu
Applications: BA
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF3767
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-45388
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-33839PEP
Species: Hu
Applications: AC

Publications for ACD Protein (NBP2-33839PEP) (0)

There are no publications for ACD Protein (NBP2-33839PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACD Protein (NBP2-33839PEP) (0)

There are no reviews for ACD Protein (NBP2-33839PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACD Protein (NBP2-33839PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACD Products

Blogs on ACD.

Bio-Techne’s CiteAb 2020 Researchers’ Choice Award
By Kate Wilmore This year Bio-Techne was honored to receive the CiteAb Researchers' Choice Award   . This award recognizes and celebrates the very best suppliers and individuals in the research reagent sec...  Read full blog post.

Application Highlight: Recent uses of TERF2 in immunofluorescence (IF)
Telomeres are a region of repeat nucleotide sequences located at the end of chromosomes to protect our DNA from becoming damaged via end-to-end fusion.  TERF2, or telomeric-repeat binding factor 2, is important for telomere integrity and aids in th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACD