ACBD3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ACBD3 Antibody [NBP1-83379] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.

Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.

Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Analysis in human cell line U-2197.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACBD3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACBD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACBD3 Protein (NBP1-83379PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACBD3 Antibody - BSA Free

• acyl-CoA binding domain containing 3
• Acyl-CoA-binding domain-containing protein 3
• acyl-Coenzyme A binding domain containing 3
• GCP60Golgi phosphoprotein 1
• GOCAP1Peripheral benzodiazepine receptor-associated protein PAP7
• golgi complex associated protein 1, 60kDa
• Golgi complex-associated protein 1
• Golgi resident protein GCP60
• GOLPH1PBR- and PKA-associated protein 7
• PAP7
• PBR associated protein
• peripherial benzodiazepine receptor associated protein
• PKA (RIalpha)-associated protein

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACBD3 Antibody (NBP1-83379)(2)

Publications using NBP1-83379

• Menegaz D, Hagan D W et al. Mechanism and effects of pulsatile GABA secretion from cytosolic pools in the human beta cell. Nat Metab 2019-01-11 [PMID: 32432213] (IF/IHC, Human)
• Teoule F, Brisac C, Pelletier I et al. The Golgi Protein ACBD3, an Interactor for Poliovirus Protein 3A, Modulates Poliovirus Replication. J Virol 2013-10-01 [PMID: 23926333]

Bioinformatics

• Gene Symbol: ACBD3