ACBD3 Antibody

Images

 
Western Blot: ACBD3 Antibody [NBP1-83379] - Analysis in human cell line U-2197.
Immunocytochemistry/ Immunofluorescence: ACBD3 Antibody [NBP1-83379] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: ACBD3 Antibody [NBP1-83379] - Staining of human duodenum shows strong granular positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACBD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACBD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACBD3 Protein (NBP1-83379PEP)
Publications
Read Publication using NBP1-83379.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (86%). Reactivity reported in scientific literature (PMID: 23926333)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACBD3 Antibody

  • acyl-CoA binding domain containing 3
  • Acyl-CoA-binding domain-containing protein 3
  • acyl-Coenzyme A binding domain containing 3
  • GCP60Golgi phosphoprotein 1
  • GOCAP1Peripheral benzodiazepine receptor-associated protein PAP7
  • golgi complex associated protein 1, 60kDa
  • Golgi complex-associated protein 1
  • Golgi resident protein GCP60
  • GOLPH1PBR- and PKA-associated protein 7
  • PAP7
  • PBR associated protein
  • peripherial benzodiazepine receptor associated protein
  • PKA (RIalpha)-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-91952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38648
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7509
Species: Hu
Applications: WB, IHC
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NBP1-56440
Species: Hu
Applications: WB
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31237
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACBD3 Antibody (NBP1-83379)(1)

Reviews for ACBD3 Antibody (NBP1-83379) (0)

There are no reviews for ACBD3 Antibody (NBP1-83379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACBD3 Antibody (NBP1-83379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACBD3 Products

Bioinformatics Tool for ACBD3 Antibody (NBP1-83379)

Discover related pathways, diseases and genes to ACBD3 Antibody (NBP1-83379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACBD3 Antibody (NBP1-83379)

Discover more about diseases related to ACBD3 Antibody (NBP1-83379).
 

Pathways for ACBD3 Antibody (NBP1-83379)

View related products by pathway.

PTMs for ACBD3 Antibody (NBP1-83379)

Learn more about PTMs related to ACBD3 Antibody (NBP1-83379).
 

Research Areas for ACBD3 Antibody (NBP1-83379)

Find related products by research area.

Blogs on ACBD3

There are no specific blogs for ACBD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACBD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACBD3