ACAT Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ACAT Antibody [NBP2-32052] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: ACAT Antibody [NBP2-32052] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of liver.
Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of liver cancer.
Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500-1:1000
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACAT Protein (NBP2-32052PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAT Antibody

  • ACACT
  • ACACT1
  • ACAT-1
  • ACATACAT1
  • acyl-Coenzyme A: cholesterol acyltransferase
  • Acyl-coenzyme A:cholesterol acyltransferase 1
  • Cholesterol acyltransferase 1
  • EC 2.3.1.26
  • RP11-215I23.2
  • STATSOAT
  • sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1
  • sterol O-acyltransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF2988
Species: Mu, Rt
Applications: WB
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NBP2-45981
Species: Hu
Applications: IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB

Publications for ACAT Antibody (NBP2-32052) (0)

There are no publications for ACAT Antibody (NBP2-32052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAT Antibody (NBP2-32052) (0)

There are no reviews for ACAT Antibody (NBP2-32052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ACAT Antibody (NBP2-32052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAT Products

Bioinformatics Tool for ACAT Antibody (NBP2-32052)

Discover related pathways, diseases and genes to ACAT Antibody (NBP2-32052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAT Antibody (NBP2-32052)

Discover more about diseases related to ACAT Antibody (NBP2-32052).
 

Pathways for ACAT Antibody (NBP2-32052)

View related products by pathway.

PTMs for ACAT Antibody (NBP2-32052)

Learn more about PTMs related to ACAT Antibody (NBP2-32052).
 

Research Areas for ACAT Antibody (NBP2-32052)

Find related products by research area.

Blogs on ACAT

There are no specific blogs for ACAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOAT1
Uniprot