Absent in melanoma 1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Absent in melanoma 1 Antibody [NBP2-38170] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & microtubules.

Immunohistochemistry: Absent in melanoma 1 Antibody [NBP2-38170] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Absent in melanoma 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Absent in melanoma 1 Antibody - BSA Free (NBP2-38170) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLMQNLDTKSKLRPKRASAEQSVLFKSLHTNTNGNSEP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRYBG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Absent in melanoma 1 Protein (NBP2-38170PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Absent in melanoma 1 Antibody - BSA Free

• AIM1
• Beta/gamma crystallin domain-containing protein 1
• beta-gamma crystallin domain containing 1
• CRYBG1
• ST4
• suppression of tumorigenicity 4 (malignant melanoma)

Background

May function as suppressor of malignant melanoma. It may exert its effects through interactions with the cytoskeleton.Represented by 298 ESTs from 137 cDNA libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CRYBG1
• Uniprot:
  • Q9Y4K1(Human)