ABHD6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ABHD6 Antibody [NBP2-57800] - Staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABHD6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABHD6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western Blot reported in scientific literature (PMID:32141088).
Control Peptide
ABHD6 Recombinant Protein Antigen (NBP2-57800PEP)
Publications
Read Publication using
NBP2-57800 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse 86%, Rat 87%. Use in Mouse reported in scientific literature (PMID:32141088).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ABHD6 Antibody

  • 2-arachidonoylglycerol hydrolase
  • abhydrolase domain containing 6
  • Abhydrolase domain-containing protein 6
  • EC 3.1.1.23
  • lipase protein
  • monoacylglycerol lipase ABHD6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-00735
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00002166-M07
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-45564
Species: Hu
Applications: IF, IHC-P, WB
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NBP1-20875
Species: Mu, Rt
Applications: PEP-ELISA, WB
AF5365
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NBP3-04922
Species: Hu
Applications: ICC/IF, WB
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NLS32
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P
DDX0010P-100
Species: Ca, Hu
Applications: Flow-CS, Flow, Func, IHC, IHC-Fr, IP, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4886
Species: Mu
Applications: IP, WB
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-57800
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for ABHD6 Antibody (NBP2-57800)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ABHD6 Antibody (NBP2-57800) (0)

There are no reviews for ABHD6 Antibody (NBP2-57800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABHD6 Antibody (NBP2-57800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABHD6 Products

Bioinformatics Tool for ABHD6 Antibody (NBP2-57800)

Discover related pathways, diseases and genes to ABHD6 Antibody (NBP2-57800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABHD6 Antibody (NBP2-57800)

Discover more about diseases related to ABHD6 Antibody (NBP2-57800).
 

Pathways for ABHD6 Antibody (NBP2-57800)

View related products by pathway.

Research Areas for ABHD6 Antibody (NBP2-57800)

Find related products by research area.

Blogs on ABHD6

There are no specific blogs for ABHD6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABHD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD6